KEGG   Mus musculus (house mouse): 73158
Entry
73158             CDS       T01002                                 
Symbol
Larp1, 1810024J12Rik, 3110040D16Rik, Larp, mKIAA0731
Name
(RefSeq) La ribonucleoprotein 1, translational regulator
  KO
K18757  la-related protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    73158 (Larp1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     73158 (Larp1)
SSDB
Motif
Pfam: La SGP DUF5320
Other DBs
NCBI-GeneID: 73158
NCBI-ProteinID: NP_082727
MGI: 1890165
Ensembl: ENSMUSG00000037331
UniProt: Q6ZQ58
Position
11:57899711..57952860
AA seq 1072 aa
MATQVEPLLPAGAPLLQAEEHGLARKKPAPDAQAESGPGDGGGEPDGGVRRPRPACARPG
RDGAERESPRPPAAAEAPAGSDGEDGGRRDFVEAPPPKVNPWTKHAPPPAAVNGQPPPEP
SAPAKVVRAAAPKPRKGSKVGDFGDAVNWPTPGEIAHKSVQPQSHKPQPARKLPPKKDMK
EQEKGDGSDSKESPKTKSDESGEEKNGDEDCQRGGQKKKGSKHKWVPLQIDMKPEVPREK
LASRPTRPQEPRHTPAVRGEMKGSEPATYMPVSVAPPTPAWQPETKVEPAWHDQDETSSV
KSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFDYQFGYRKFDGTEGPRTHKYMNNITY
YFDNVSSNEIYSMDQELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFH
RVQALTTDISLIFAALKDSKVVEMVEEKVRRREEPEKWPLPGPPIVDYSQTDFSQLLNCP
EFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKTLPKGLSASLPDLDSESWIEVKKR
PRPSPARPKKPEEPRFSHPTALPQQLPSQQLMSKDQDEQEELDFLFDEEMEQMDGRKNTF
TAWSEEDSDYEIDDRDVNKILIVTQTPPYMRRHPGGDRTGNHTSRAKMSAELAKVINDGL
FYYEQDLWTEKFEPEYSQIKQEVENFKKVNMISREQFDTLTPEPPVDPNQEVPPGPPRFQ
QVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNARTPRTPRTPQLKDSSQTPRFYPV
VKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSREHRPRTASISSSPSEGTPAVGSYG
CTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFL
RDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYE
AGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVDPPMGEEGNHKRHPVVA
GGSGEGRKRCPSQSSSRPATGISQPPTTPTGQATREDAKWTSQHSDTLTLRK
NT seq 3219 nt   +upstreamnt  +downstreamnt
atggccactcaagtggagccgctgctgccggcgggcgccccgctgctgcaggccgaggag
cacggcctggcgaggaagaagccggcgcccgacgcccaggccgagtcgggcccgggtgac
ggcggcggagagcccgacggcggcgtccgcaggccgcggcccgcctgcgccaggcctggc
cgcgacggcgcggagcgcgagagcccgcggccacccgcagctgcggaagccccagcgggg
agcgacggcgaggacggcggccggcgtgacttcgtggaggcaccgccgcccaaggtgaac
ccgtggacgaagcacgcgccgccgccggccgcggtgaacggacagccgcctccagaacct
tctgctccagccaaggtggtgagggcagctgctcctaaaccgcgtaagggcagcaaggtt
ggtgattttggagatgcagtcaactggcctacacctggagagatagcccacaaaagtgtg
cagccacagtcccacaagcctcagcctgctcgtaagttgccacctaagaaggacatgaag
gagcaagagaaaggagatggaagtgatagtaaggagagcccaaaaacaaagtcggatgaa
tcgggggaggaaaagaatggggatgaggactgccagcgaggcgggcagaagaagaaaggg
agcaaacacaagtgggttccattgcaaatagacatgaagcccgaagtacccagagagaaa
ttggcctcccgtcccactcgcccacaggaaccaagacatacacccgctgtccgtggggag
atgaaaggatctgaacctgccacctacatgcctgtatctgtggccccacccaccccagcc
tggcaaccagagaccaaagtggagcctgcctggcacgaccaggatgagacatcgagtgtg
aagagtgatggggctggtggggctcgggcttccttccgtggccgtggacgggggcgtggt
cgtggacggggccgtggacggggtggcactcgaacccactttgactaccagtttggctac
cgaaagtttgatggtacagaggggccccgcacccacaagtatatgaacaacatcacttac
tactttgacaatgtcagcagcaatgagatttacagtatggaccaggagctgctcaaggat
tatatcaaacgccagattgaatattacttcagcgtggacaatttagagcgagacttcttc
ctgagacggaaaatggatgctgatggcttccttcccatcacccttattgcttcctttcac
cgtgtacaggccctaaccactgacatttcactcatctttgcggctctaaaggacagcaag
gtggtagagatggttgaggagaaagtccgcaggagggaagaacctgaaaagtggccactg
cctggacccccaatagtggattattcacaaactgatttttctcagcttctcaactgccca
gagtttgttccccgccagcactaccagaaagagacagagtcggcacctggctctccccgt
gcagtcaccccagtgccaacaaaaacagaggaggtcagcaacctgaagacccttcccaag
ggcctgtctgccagcctcccagatctggattctgagagctggattgaagtgaagaaaagg
cctcgaccctcaccagcacgccccaagaagccagaggagcccaggttctcccacccaact
gctctgcctcagcagcttccctcccagcagctgatgtctaaggatcaggatgagcaagaa
gaactagactttctgtttgacgaggagatggagcagatggatgggcggaagaataccttc
actgcctggtctgaagaggactctgactatgaaattgatgaccgggatgtcaataagatc
ctcatcgtcactcaaacaccaccttacatgcgtcgccaccctggaggagaccgtacaggc
aaccacacttcgcgtgccaagatgagtgctgaactggccaaggtcattaatgatggactc
ttctactatgaacaagacctgtggactgagaagtttgagcctgagtattcacagatcaag
caagaagtggaaaacttcaagaaagtgaatatgattagtcgggaacagtttgacactctg
acccctgagccccctgtggatcctaaccaggaggttcctcctgggccacctcggttccaa
caagttcctactgatgccctggccaacaagctgtttggtgctcccgagccatctaccatt
gcccgttctctaccaaccactgtcccagagtctccaaactaccgaaatgccaggactccc
cgcacaccccggaccccccagctcaaagactctagtcagacaccacggttttaccctgtg
gtgaaagaaggacggaccctagatgccaagatgcctcgaaaaagaaagacaaggcacagc
tcgaacccccccttggaaagtcatgtgggctgggtgatggattctcgggagcacaggccc
aggactgcttctattagctccagtccttcagagggaacacctgcagtcggcagctatggc
tgtacccctcagtcactgcccaagttccagcatccttcccatgagctgctcaaggaaaat
ggcttcacacaacacgtctaccacaagtatcggaggcgctgccttaatgagcggaagcgc
ttgggcattggccagtctcaggagatgaacaccctcttccgcttttggtccttcttcctc
cgagatcacttcaataaaaagatgtatgaagagttcaagcagctcgcactggaggatgcc
aaagaaggctacaggtacggtttggagtgcctttttcgatactacagttatggtctagag
aaaaagttccggctggacatattcaaggatttccaggaggagacagtgaaggactatgag
gctggccagctctatggattggagaagttctgggccttcttgaaatactccaaagccaaa
aatttggacattgaccccaaactgcaagaatacctcggcaaattccgccgcttagaagac
ttccgagtggacccccccatgggcgaggaaggcaaccacaagcgacacccagtggtagca
ggaggcagcggagagggcaggaagcggtgcccttcccagtcttccagcaggcctgccact
gggatcagccaaccccctacgacacctactggccaggccactcgagaagatgccaaatgg
acaagccagcactcggacacactgactttgcgaaagtga

DBGET integrated database retrieval system