KEGG   Mus musculus (mouse): 73166
Entry
73166             CDS       T01002                                 

Gene name
Tm7sf2, 3110041O18Rik, AN, ANG1, C14SR, Dhcr14
Definition
(RefSeq) transmembrane 7 superfamily member 2
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00100  Steroid biosynthesis
mmu01100  Metabolic pathways
Module
mmu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    73166 (Tm7sf2)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     73166 (Tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 73166
NCBI-ProteinID: NP_082730
MGI: 1920416
Ensembl: ENSMUSG00000024799
Vega: OTTMUSG00000024785
UniProt: Q71KT5 Q3V3I6
Position
19; 19 A
AA seq 418 aa
MTSREASQAPLEFGGPLGVAALLILLPATMFHLLLAARSGPARLLALPAYLPGLEELWSP
WALLLLFIWLGLQVALYLLPARKVAEGLELKDKSRLRYPINGFQALVLTALLMGLGVSVG
LPLGALPGMLLPLAFATTLTSFIFSLLLYAKALVAPASALAPGGNSGNSMYDFFLGRELN
PRLGSFDFKYFCELRPGLIGWVFINLALLMQEAELRGSPSLAMWLVNGFQLLYVGDALWY
EESVLTTMDIIHDGFGFMLVFGDLAWVPFTYSLQAQFLLYHPQPLGLPMALLICLLKVIG
YYIFRGANSQKNTFRKNPSDPSVAGLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALA
WSLPCGLSHLLPYFYVLYFTALLVHREARDEQQCLQKYGRAWQEYCKRVPYRIIPYVY
NT seq 1257 nt   +upstreamnt  +downstreamnt
atgacttctcgtgaggcctcccaggccccactggaattcggggggccgttgggcgtcgcg
gctttactgatcctgctgcctgccaccatgttccacctgctcctggcggctcgctcgggc
ccggcgcgcctcctggccctaccggcctatctgcctgggctggaggagctgtggagccca
tgggctctgctgctattgttcatctggctcggcctgcaggtggcgctctatttgctgcct
gcacgcaaggtggccgaaggcctggaactgaaggacaagagtcgcctgcgctaccctatt
aatggcttccaggctctggtgctaacagccctgttgatggggctgggggtgtcagtgggg
ctgcccctgggggcactccctggaatgctcctgcccttggcctttgcgaccactctcacc
agctttatcttcagcctcctcctctatgcgaaggctttggtagctcctgcctcagccctg
gctcctgggggaaactcaggaaattccatgtatgacttctttcttggacgggagctgaac
cctcgcctcggttcctttgacttcaaatatttctgtgagctgagacctggcctcattggc
tgggttttcattaacctggccctgctgatgcaggaggcagagcttcgggggagtccttcc
ctggctatgtggctggtcaatggcttccagttgctgtatgtgggtgatgccctctggtat
gaggagtctgtcctcaccaccatggacataatacatgatggttttggcttcatgctggtc
tttggagatctagcttgggtaccattcacctacagcctgcaggcccagttcctgttgtac
catccacagcctctggggttgcccatggccttgctcatctgcctccttaaggttattggt
tactacatcttccgaggggccaactcccagaaaaacacattcaggaagaatccttctgac
cccagcgtggctggtcttgagaccatcccgactgccacggggaggcagctgctggtgtct
gggtggtggggtatggttcgacaccccaactacctgggagatctcatcatggctctggca
tggtctttgccctgtgggctatcccatctgctgccctacttctacgtcctctacttcact
gcactgctggtgcaccgcgaggccagagatgagcagcagtgcctccaaaagtatggccgt
gcctggcaggagtactgcaagcgtgtgccttaccgaatcataccctatgtctactga

DBGET integrated database retrieval system