KEGG   Mus musculus (house mouse): 73167
Entry
73167             CDS       T01002                                 
Symbol
Arhgap8, 3110043J09Rik
Name
(RefSeq) Rho GTPase activating protein 8
  KO
K20633  Rho GTPase-activating protein 8
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73167 (Arhgap8)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    73167 (Arhgap8)
SSDB
Motif
Pfam: RhoGAP CRAL_TRIO_2 CRAL_TRIO
Other DBs
NCBI-GeneID: 73167
NCBI-ProteinID: NP_001158099
MGI: 1920417
Ensembl: ENSMUSG00000078954
UniProt: Q9CXP4
Position
15:84604214..84657058
AA seq 425 aa
MAGLDPTLSTSHPFYDVARHGILQVAGDDRQGRRIFTFSCCRLPPLHQLNHQRLLEYLKY
TLDQHVENDYTIVYFHYGLSSQNKPSLGWLQNTYKEFDRKYKKNLKALYVVHPTSLIKAL
WNIFKPLISHKFGKKVTYCSNLRELREHLQCDQLLIPPEVVRYDEKLQNLHKGQPPPPTK
TPPPRPPLPTQQFGVSLQYLRDKNQGELIPPVLRWTVTYLREKGLRTEGLFRRSASAQTV
RQVQRLYDQGKPVNFDDYGDMHLPAVILKTFLRELPQPLLTFQAYEQILGITSVESSLRV
THCRLILRSLPEHNYAVLRYLMGFLHEVSLESISNKMNSSNLACVFGLNLIWPSQGVASL
SALVPLNLFTELLIEYYDKVFSCQEAPGEHTRDTVEVQQAGPVTKEFMKTGTPRASPYLS
RLRIS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggctggcctggaccccacactgagcacaagtcacccattctatgatgtggccagacac
ggcatcctgcaggtggcaggggatgaccgccaggggagacgcatcttcactttcagctgc
tgccggctgccacccttgcaccagctcaaccaccagcgcctgctggagtatctgaagtac
acactggaccagcatgtggagaacgactatactattgtctactttcactatggcctcagc
agccagaacaaaccatccctaggctggctccagaacacctacaaggagtttgaccggaag
tacaagaagaacctgaaggcactgtacgttgtacaccccaccagcctcatcaaagcactg
tggaacatcttcaagcccctcatcagtcacaagtttgggaaaaaagtcacctactgcagc
aacctgcgtgagctccgagaacaccttcagtgcgaccagctgctcatccccccggaagta
gtgcggtatgacgagaaactgcaaaacctgcacaaaggtcaaccgcccccgcccaccaag
acaccgccacctcggccgcctctgcccacccagcagtttggcgtcagcctgcaatacctc
agagacaaaaatcaaggtgaactcatccccccggtgctgcgttggacggtgacatatctg
agagaaaaaggactgcgcactgagggcctgttccggagatcggccagcgcccagactgtc
cgtcaggtgcagcggctatatgatcaagggaagcccgtgaactttgatgattatggagac
atgcacctcccagccgtgatcctgaagacatttctccgagagctgccccagccactgctg
accttccaagcctacgagcagattctcgggatcaccagtgtggagagcagccttcgagtg
acccactgccgcctgatcctgcggagcctcccagaacacaactatgccgtactccgctac
ctcatgggcttcctgcatgaagtgtctctggagagcatttcaaacaagatgaacagctct
aacctggcgtgcgtgtttggattgaacttgatctggccatcccagggggtggcttccctg
agcgccctggtacctctgaacttgttcacagagctgctgatagagtactatgacaaagtc
ttcagttgccaggaggcccctggggagcacacccgggatactgtggaagtacagcaggct
ggccctgttaccaaagaatttatgaagacgggcactccccgggcctcaccatacctgtcc
cgcctccgtatctcctga

DBGET integrated database retrieval system