KEGG   Mus musculus (mouse): 73178
Entry
73178             CDS       T01002                                 

Gene name
Wasl, 2900021I12Rik, 3110031I02Rik, N-, N-WASP
Definition
(RefSeq) WASP like actin nucleation promoting factor
  KO
K23612  neural Wiskott-Aldrich syndrome protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04144  Endocytosis
mmu04520  Adherens junction
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05132  Salmonella infection
mmu05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    73178 (Wasl)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    73178 (Wasl)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    73178 (Wasl)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    73178 (Wasl)
   05135 Yersinia infection
    73178 (Wasl)
   05100 Bacterial invasion of epithelial cells
    73178 (Wasl)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73178 (Wasl)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    73178 (Wasl)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    73178 (Wasl)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     73178 (Wasl)
SSDB
Motif
Pfam: WH1 PBD WH2 DUF4918 PQQ
Other DBs
NCBI-GeneID: 73178
NCBI-ProteinID: NP_082735
MGI: 1920428
Ensembl: ENSMUSG00000029684
Vega: OTTMUSG00000037666
UniProt: Q91YD9 Q3TXX8 Q6PDL3
Position
6; 6 A3.1
AA seq 501 aa
MSSGQQPPRRVTNVGSLLLTPQENESLFSFLGKKCVTMSSAVVQLYAADRNCMWAKKCSG
VACLVKDNPQRSYFLRIFDIKDGKLLWEQELYNNFVYNSPRGYFHTFAGDTCQVALNFAN
EEEAKKFRKAVTDLLGRRQRKSEKRRDAPNGPNLPMATVDIKNPEITTNRFYGSQVNNIS
HTKEKKKGKAKKKRLTKADIGTPSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISE
AQLKDRETSKVIYDFIEKTGGVEAVKNELRRQAPPPPPPSRGGPPPPPPPPHSSGPPPPP
ARGRGAPPPPPSRAPTAAPPPPPPSRPGVVVPPPPPNRMYPPPPPALPSSAPSGPPPPPP
PSMAGSTAPPPPPPPPPPPGPPPPPGLPSDGDHQVPAPSGNKAALLDQIREGAQLKKVEQ
NSRPVSCSGRDALLDQIRQGIQLKSVSDGQESTPPTPAPTSGIVGALMEVMQKRSKAIHS
SDEDEDDDDEEDFEDDDEWED
NT seq 1506 nt   +upstreamnt  +downstreamnt
atgagctcgggccagcagcccccgcggagggtcaccaacgtgggctccctgctgctcacc
ccgcaagagaacgagtctctcttctccttcctcggcaagaaatgtgtgactatgtcttca
gcagtggtgcagttgtatgcagcagatcggaactgtatgtgggcaaagaagtgcagtggt
gtcgcttgtctggttaaggacaatcctcagagatcttattttttaagaatatttgacatt
aaggatgggaaattactgtgggaacaagagctatacaataactttgtatataatagtcct
agaggatattttcatacctttgctggagatacttgtcaagtagctcttaattttgccaat
gaagaagaagcaaaaaagttccgaaaagcagttacagacctgttgggccgacgacaaagg
aaatctgaaaaaagacgagatgctccaaatggtcccaatctacccatggctacagttgac
ataaaaaatccagaaatcacaacaaatagattttatggttcacaagtcaacaacatctcc
cacaccaaagaaaagaagaaaggaaaagctaaaaagaagagattaaccaaggcagatatt
ggaacaccaagtaatttccagcacattgggcatgttggatgggatccaaatacaggtttt
gatctaaataatttggatccagaattaaagaatctttttgatatgtgtgggatctctgag
gcccagcttaaagacagagaaacatcaaaagttatttatgactttattgaaaaaacagga
ggtgtagaagctgttaaaaacgaactccgaagacaagcaccaccaccacctccaccctcg
agaggaggacctccccctcctcctccccctcctcatagctcaggtcctcctccccctcct
gcccgaggaaggggggctcctcctcccccaccttcaagagctcctactgctgcacctcca
cctccacctccttctaggcctggtgttgttgttcctccgccccctccaaacaggatgtac
cctcctccaccaccagcgctgccctcttcagcaccttcaggccctccaccacctccacct
ccatctatggcagggtccacagcaccaccacctcctcctccacctccgcccccaccaggg
ccaccacctccccctggcctgccttctgatggtgaccatcaagttccagctccttcagga
aacaaagcagctcttttggatcaaattagagagggtgctcagctgaaaaaagtggaacag
aatagccggcccgtgtcctgctcaggaagggatgcgcttttagaccagatacgacagggc
attcaattgaaatctgtgtctgatggccaagagtccacaccaccaacacccgcacccact
tcaggaattgtgggtgcgctgatggaagtgatgcagaaaaggagcaaagccattcattcc
tcagatgaagatgaagacgatgatgatgaagaagattttgaggatgatgatgagtgggaa
gactga

DBGET integrated database retrieval system