KEGG   Mus musculus (mouse): 73212
Entry
73212             CDS       T01002                                 

Gene name
3110082I17Rik, AW411904
Definition
(RefSeq) RIKEN cDNA 3110082I17 gene
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: WKF YL1
Other DBs
NCBI-GeneID: 73212
NCBI-ProteinID: NP_082745
MGI: 1920462
Ensembl: ENSMUSG00000053553
Vega: OTTMUSG00000035852
UniProt: Q9CXL3
Position
5; 5 G2
AA seq 195 aa
MAKHKRKGLEGTGKESKRQKITPAEETPRTSEAGPDKETASTLVQEASPELSPEERRVLE
RKLKKERKKEEKKRLREAGIAATQTAKVQTLPAKPSAATLALEYLQGWAQKQESWRFQKT
RQTWLLLHMYDEDKVPDEHFPTLLDYLEGLRGSARELTVRKAEALMQKLDEAEPEDSGGS
PGKVQRLRQVLQLLS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggcaaaacataagcgaaaaggtctcgaagggacaggaaaggagagtaaaaggcagaaa
ataacaccggcagaggagacgccgaggacatcggaggctgggccagacaaggagacggcc
agtaccctggtgcaggaggccagccctgagttgtccccagaggagaggagagtcttggaa
aggaaactgaagaaggaacggaagaaggaagagaagaaacggctgagggaggcgggcatc
gctgctacacagactgccaaggttcagacgctgccagccaagccctcggctgccaccctg
gctctggagtacctccaagggtgggctcagaagcaggagagctggcggttccagaagaca
agacagacgtggctcctgctgcacatgtatgatgaggacaaggttcctgatgagcacttt
cctaccctgctggactacctggaggggctgcggggcagtgcccgggagctcacagtccgg
aaggcagaggccctgatgcagaagctcgatgaggctgagcctgaggacagcggcgggtct
ccggggaaggtgcagcgcctccgccaggtgctgcagctgctctcctag

DBGET integrated database retrieval system