KEGG   Mus musculus (mouse): 73254Help
Entry
73254             CDS       T01002                                 

Gene name
Ccdc18, 1700021E15Rik, 4932411G06Rik, NY-SAR-41
Definition
(RefSeq) coiled-coil domain containing 18
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 73254
NCBI-ProteinID: NP_082757
MGI: 1922974
Ensembl: ENSMUSG00000056531
Vega: OTTMUSG00000053963
UniProt: Q640L5
Position
5; 5 F
AA seq 1455 aa AA seqDB search
MEFISSDYCTKDNDNEEESLLANVASLRHELKITEWSLHNLGEELSSVSPSENSEYVCSP
SRSERLILEELTQPSHLGRLIYPPYKKVCKTSDSTDYQKKSRDQVSFSSVSMDQEVKNLR
EKLHKLRQQNACLVTQNHSLMTKIESVHFELTQSKAKIAMLESAQEQAANIPILEEQIIN
LEAEVSAQDKVLREAEDKLEQSQKMVIEKEHSLQEAKEECIKLKVDLLEQSKQGKRAERQ
RNEALYNAEELSKAFQLYKEKVAEKLEKVQDEEEILERNLSNCEKENKRLQEKCNLYKSE
LEILKEKFRELKEEHYSGKEKLMIMAMKNSEVMSQLTESRQCILKLERELEDKDEIVREK
FSLLNENRELKVRVATQNERLELCQQDIDNSRVELKSLEKLITQIPLKREIVGFRSSLCK
HQRSSVSDKEDKCIGCCEANKLMISELRIKLAIREAEIQKLHANLTVNQLSQNVANDSQE
CGKVNTLETEPVKLGGSQVESIKDGDQQTVNKQYEREKQRLATGIEELRAKLTQIEAENS
DLKVNMAHRTSQFQLIQEELLEKASNASKLENEMTKKCSQLLILEKQLEEKIIAYSSIAA
KNAELEQELMEKNEKIRSLESNINTEHEKICFAFEKAKKIHLEQHKEMEKQIEQLETQLE
KRDQQFKEQEKTMSILQQDILCKQHHLESLDRLLTESKVEMEKENMKKDEALKALQIHVS
EETIKVRQLDSALEICKEELALHLNQLERNKEKFERQLKKKSEEVYCLQKELKIKTHNLE
ETSEQNAILQHTLQQQQQMLQQETMRNGELEDTQSKLEKQVSKQEQELQKQRESSTEKLR
KMEEKYETAIREVDLKRQKIIELTGTARQAKLEMDQYKEELSKMEKEIIHLKRDGENKSM
QLSQLDMVLDQTKTELEKTTNSVKELERLQHHTETELTETMQKREALENELQNAHGELKS
TLRQLQELRDVLQKAQLSLEEKYTTIKDLTAELRECKMEIEDKKQELIEMDQALKERNWE
LKQRAAQVTHLDMTIREHRGEMEQKIIKLEGTLEKSELELKECNKQVESLNEKLQNAKEQ
LREKEFIMLQNEQEISQLKKEIERTQQRMKEMESVIKEQEDYIATQYKEVIDLGQELRLT
QEQMQNTHSELVEARRQEVQAQREIERLAGELEDIKQLSKEKEAHGNRLAEELGASQVRE
AHLEARMQAEIKKLSSEVDSLKEAYQIEMISHQENHAKWKLSAESQKTSVQQLNEQLEKA
KQELEEAQDTVSNLHQQVQDRNEVIEAANEALLIKESELTRLQAKISGHEKTEDTKYLPA
PFTTLTEIIPDSQHPNFAKHSQISLFKCRKLRRSISASDLSFKSHGNDDLSEELLQDLKK
MQFEQTSAIESGHKDLPLTHSESFKPLPYNLEDDSSESNDFSTLSGMLRYINKEVRLLKK
SSLQTATGLSQGGKL
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atggaatttatctcatcagactactgtactaaagacaacgacaatgaggaggaaagtttg
cttgcaaacgttgcttcattaagacatgaactcaaaataacagaatggagtttgcacaat
ttaggggaagagttatccagtgttagtccaagtgaaaattctgagtatgtctgcagtcct
tcaagatctgaaaggcttattttggaagaactcacccaacctagccacctgggacgtttg
atttacccaccttataagaaagtttgtaaaacatctgatagtactgattatcaaaagaaa
tcaagagatcaggtgtctttttcatctgtttctatggatcaagaggttaaaaaccttcga
gagaaacttcataaacttaggcaacagaatgcttgtttggtcacacagaatcattcttta
atgactaaaatagaatctgtccactttgaattgacacaatcaaaagcaaaaattgctatg
cttgagtctgcacaagagcaggcagccaacattccaatcttagaagaacagattataaat
ttggaagcagaagtttcagctcaagataaagttttgagagaagcagaagataaattagag
cagagtcagaaaatggtgattgaaaaggagcacagtttacaagaggccaaagaagagtgt
ataaaattgaaggtggacttacttgaacagagtaaacaaggaaaaagagctgagcgacaa
aggaatgaagccctctataatgcagaagagctgagtaaggccttccagctgtacaaagaa
aaagtggctgaaaaactggaaaaggttcaagatgaagaagaaatattagagagaaatctt
agtaactgtgaaaaggaaaataaaaggcttcaagaaaagtgtaatctgtataaaagtgaa
cttgaaattttgaaagagaaattcagggagttaaaagaagaacattacagtggaaaagaa
aaattaatgattatggcaatgaaaaactcagaagtcatgtcacagttaacggaatctaga
caatgtattctgaagctagagagggagttagaggacaaagatgaaatagtacgagaaaag
ttttccttattaaatgaaaatcgagaattgaaggttcgtgttgcaacacagaatgaacga
ctagagttgtgtcagcaggacattgataattcaagggtggaactgaagagtttagaaaaa
ctgataacccagataccattaaaaagagaaatagttggctttaggtcatctctttgtaag
caccagaggagtagtgtttctgacaaggaggacaaatgcattggctgctgtgaggcaaat
aaactcatgatttctgaattgaggattaagcttgcaataagagaggctgaaattcaaaag
cttcatgcaaatctgactgtgaaccagctctctcaaaatgttgctaatgatagtcaagaa
tgtggtaaagtaaacacgttagaaacagaaccggtaaaattaggaggtagtcaagtcgaa
agtataaaggatggagatcagcagactgtgaacaagcagtatgaaagagagaagcagcga
cttgctaccgggatagaagaactgcgtgctaagctgacacagatagaagctgagaactct
gacttgaaggttaacatggcacacagaactagtcagtttcagctaattcaagaggaacta
ctagagaaagcttcaaatgctagcaaactagaaaatgaaatgacaaagaagtgttctcaa
cttttaattctagagaaacagctagaagaaaaaattattgcatattcttctattgctgca
aaaaatgcagaacttgaacaagaacttatggagaaaaatgaaaaaataagaagcctagaa
tcaaatatcaacacagaacatgagaaaatttgttttgcttttgaaaaagcaaagaaaatt
catcttgaacagcataaggaaatggaaaaacagattgagcaactcgaaactcaactggag
aaaagagaccaacagtttaaagaacaagaaaagactatgtccattttgcagcaagatata
ctgtgtaaacagcatcaccttgaatcactagatagactcttgacagaaagtaaagtggaa
atggaaaaagaaaatatgaagaaagatgaagctttaaaagcattgcagattcatgtatct
gaagaaacaatcaaggtcagacaactggattcagcgttagaaatctgtaaggaagagctt
gctttgcatttgaatcaattggaaagaaataaggaaaaatttgaaagacagctgaagaag
aaatctgaagaggtatattgtttgcagaaagagctaaagataaagactcataatcttgaa
gagacgagtgaacaaaatgccatcctacagcacactcttcagcagcagcagcagatgtta
cagcaagagaccatgagaaatggagagctagaagatactcagagtaaacttgaaaaacag
gtatcaaagcaagaacaagagcttcagaaacaaagggaaagttcaacagaaaagttgaga
aaaatggaagagaaatatgaaacagccatacgtgaagtggatttgaaaaggcaaaaaatt
atcgagctaactggtactgccaggcaagccaaacttgagatggatcagtacaaagaggag
ctgtctaaaatggaaaaagaaataattcatttgaagcgagatggggaaaataaatccatg
cagctttctcagttagatatggttttagatcaaacaaaaacagaactagaaaagacaaca
aattcagtgaaggagttagaaaggttacaacaccacacagaaactgaattaacagaaacc
atgcagaaacgggaagctctcgaaaacgaactacagaatgctcatggagaattgaaaagt
accttaagacaactacaggaattgagagatgtattacaaaaggctcagttatcattagag
gaaaaatacactacaataaaggatctcactgctgaactgagagaatgtaagatggagatt
gaagacaaaaaacaagaacttattgaaatggatcaggcgcttaaggagagaaattgggag
ctaaagcaaagagcagctcaggttacacatttggatatgactattcgtgaacacagagga
gaaatggagcaaaaaataatcaaattggagggtaccctggaaaaatcagaattagaactt
aaagaatgcaacaaacaggtagaaagcttaaatgaaaagttgcaaaatgccaaagaacag
cttcgagaaaaggagtttataatgctccaaaatgaacaggagatatcacaactgaaaaag
gaaatcgaaagaacacagcaaaggatgaaagaaatggaaagtgttataaaagaacaggaa
gactacattgctacccagtacaaggaggtcattgatttggggcaagaattgaggctaacc
caggagcaaatgcagaacactcattcagaactggtggaggctcgtcgccaagaagtccaa
gcacagagggaaatagaaaggcttgctggtgaactggaggatataaaacaactctctaaa
gagaaggaagctcatggaaatcgtttggctgaagaactgggggcttctcaagtacgtgaa
gctcatttagaagcaagaatgcaagcagaaataaagaaattatcctcagaagtagactct
ctgaaagaagcttatcagatagagatgatttcacatcaagagaaccatgcaaagtggaag
ctttctgctgaatctcagaagacgtctgttcaacaactgaatgaacaactagagaaagcg
aaacaagaattggaagaagctcaggatactgtgagcaatttgcatcaacaagttcaagac
aggaatgaagtcattgaagctgcaaatgaagcattacttattaaagaatcagaattaacc
agattgcaagccaaaatttctggacatgaaaagacagaagacaccaagtatctaccagct
ccgtttacaactctaacagaaattatacctgatagtcaacatccaaattttgccaaacat
tctcagatatcacttttcaaatgcagaaaactacgtcggtctattagtgccagtgacctg
agtttcaaaagtcatggtaatgacgatctctctgaagaattgctacaggacttaaaaaaa
atgcaatttgagcagacttcagcgatagaaagtggtcataaagacctacctttaacccat
tcagagtcatttaaacctctcccgtataacctagaagatgatagttctgaaagtaatgac
ttcagtactcttagtggaatgctgagatacataaacaaagaagtgagactgctgaaaaaa
tcttctctgcaaacagctactggtttaagtcagggaggaaaattgtaa

DBGET integrated database retrieval system