KEGG   Mus musculus (mouse): 73274
Entry
73274             CDS       T01002                                 

Gene name
Gpbp1, 1700034P14Rik, AU019836, D230035M11Rik, Gpbp, mGPBP
Definition
(RefSeq) GC-rich promoter binding protein 1
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Vasculin
Other DBs
NCBI-GeneID: 73274
NCBI-ProteinID: NP_001116435
MGI: 1920524
Ensembl: ENSMUSG00000032745
Vega: OTTMUSG00000019752
UniProt: Q6NXH3
Position
13; 13 D2.2
AA seq 473 aa
MAQHDFAPAWLNFPTPPSSTKSSLNFEKHSENFSWTENRYDVSRRRHNSSDGFDSGIGRP
NGGNFGRKEKNGWRTHGRNGTENINHRGGYHGGNSRSRSSIFHSGKSQGLHENSIPDNET
GRKEDKRERRQFEAEDFPSLNPEYEREPNQNKSLAAGVWDYPPNPKSRTPRMLVIKKGNT
KDLQLSGFPVAGNLQSQPVKNGTGPSVYKGLVPKPAVPPTKPTQWKSQTKENKVGTSFSH
ESTYGVGNFNTFKSTAKNISPSTNSVKECNRSNSSSPVDKLNQQPRLTKLTRMRSDKKSE
FLKALKRDRVEEEHEDESHAGSEKDDDSFNLHNSNTTHQERDINRNFDENEIPQENGNAS
MISQQIIRSSTFPQTDVLSSSLEAEHRLLKEMGWQEDSENDETCAPLTEDEMREFQVISE
QLQKNGLRKNGILKNGLICDFKFGPWKNSTFKPTIENDDTETSSSDTSDDDDV
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgcagcatgactttgctccagcctggcttaattttcctactcctccatcatcaaca
aagtcatcattgaattttgagaagcactctgaaaatttttcatggacagaaaatcgttat
gatgtgagtcgtcgacgacacaattcttcagatggctttgattctggtattggacgtcct
aatggaggtaattttgggaggaaagagaaaaatggatggcgtacgcatggcagaaatggt
acagaaaacataaatcatcgtgggggataccatggtggaaattcccgttctcgtagcagt
attttccattctggaaaaagccaaggactacatgaaaacagcatccctgacaatgaaact
gggaggaaagaagacaaaagagaacgcagacagtttgaggctgaggattttccatcttta
aatcctgaatatgagagagaaccaaatcagaataaatctttagctgcgggtgtttgggac
tatcccccgaatcctaaatctagaactccaagaatgctggtcattaagaaaggtaataca
aaagacttacagctatctggattcccagtagcaggaaacctccagtcacagccagttaag
aatggaactggtccaagtgtttataaaggcttagtccccaaacctgctgttccacctaca
aaacctacacaatggaaaagccaaactaaagaaaacaaagtcgggacttctttttctcat
gaatctacatatggtgttggcaactttaatacttttaagtcaacggccaagaatattagt
ccatcaacaaattcagtgaaagagtgtaatcgttcaaattcttcttcgcctgttgacaaa
cttaatcagcagcctcgtttaactaaactgacacgaatgcgcagcgataaaaagagtgaa
tttttgaaagcattgaaaagggacagagtggaggaggaacatgaagatgaaagtcatgct
ggctcagagaaggacgacgactcatttaatttgcataacagcaatactactcaccaagaa
agagatataaacagaaactttgatgaaaatgaaattccacaggagaacggcaatgcctcg
atgatttctcaacagatcattcgttcttcgacttttccacaaactgatgttctttccagt
tcactagaggcagaacacagattattaaaagaaatgggctggcaggaagacagtgaaaat
gatgaaacatgtgctcccttaactgaggatgaaatgagagaattccaagttattagtgaa
cagttacagaagaatggtctgagaaaaaatggtattttgaaaaatggcctgatctgtgac
ttcaagtttggaccctggaaaaacagcactttcaaacccacaattgagaatgatgacaca
gagacaagtagcagcgacacgtcggatgatgacgatgtgtga

DBGET integrated database retrieval system