KEGG   Mus musculus (mouse): 73284Help
Entry
73284             CDS       T01002                                 

Gene name
Ddit4l, 1700037B15Rik, 1700108M02Rik, REDD2, RTP801L, Smhs1
Definition
(RefSeq) DNA-damage-inducible transcript 4-like
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: RTP801_C
Motif
Other DBs
NCBI-GeneID: 73284
NCBI-ProteinID: NP_084419
MGI: 1920534
Ensembl: ENSMUSG00000046818
Vega: OTTMUSG00000035296
UniProt: Q8VHZ5 B2RVG4
Position
3; 3 G3
AA seq 193 aa AA seqDB search
MVATGSLSSKNPASISELLDGGYHPGSLLSDFDYWDYVVPEPNLNEVVFEETTCQNLVKM
LENCLSRSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKK
LDRIVCDASVVPTFELTLVFKQESCPWTSLKDFFFSRGRFSSGLKRTLILSSGFRLVKKK
LYSLIGTTVIEEC
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggttgcaacgggcagtttgagcagtaagaacccggccagcatttcagagttgttggac
ggtggctatcaccctgggagtctgctaagtgatttcgactactgggattatgttgtccct
gagcccaacctcaacgaggtggtatttgaagagacaacatgccagaatttggttaaaatg
ttggagaactgtctgtccagatcaaagcaaaccaaacttggttgctctaaggtcttggtc
cctgagaaactgacccagagaattgctcaagatgtcctgcggctctcgtccacggagccc
tgcggccttcggggttgtgttatgcacgtgaacttggagattgaaaatgtatgtaaaaag
ctggataggatcgtgtgtgatgctagcgtggtgccgacctttgagctcacgcttgtgttt
aagcaggagagctgcccgtggaccagcctcaaggacttcttctttagcagaggtcgcttc
tcctcaggccttaagcgaactctgattctcagctcaggatttcgacttgtgaagaaaaaa
ctgtactccctgattggaacgacagtcattgaagagtgctaa

DBGET integrated database retrieval system