KEGG   Mus musculus (house mouse): 73288
Entry
73288             CDS       T01002                                 
Symbol
Vps50, 1700034M03Rik, 8430415E05Rik, BLM, C87205, Ccdc132, mKIAA1861
Name
(RefSeq) VPS50 EARP/GARPII complex subunit
  KO
K23288  syndetin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73288 (Vps50)
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Others
   EARP complex
    73288 (Vps50)
SSDB
Motif
Pfam: Vps54_N DUF2451
Other DBs
NCBI-GeneID: 73288
NCBI-ProteinID: NP_077222
MGI: 1920538
Ensembl: ENSMUSG00000001376
UniProt: Q8CI71
Position
6:3498393..3603531
AA seq 964 aa
MQKIKSLMTRQGLKSPPESLNDLGAFESLRVPGKEEFRELREQPSDPQAEQELINSIEQV
YFSADPFDIVKYELEKLPPVLNLQELEEYRDKLKQQQSAVSKKVADLILEKQPAYVKELE
RVTSLQTGLQLAAVICTNGRRHLNIAKEGFTQASLGLLANQRKRQLLIGLLKSLRTIKTL
QRTDIRLSEMLEEEDYPGAIQLCLECQKAASTFKHYSCISELNSKLQDTLEQIEEQLDVA
LSKICKNFDINHYTKVQQAYRLLGKTQTAMDQLHMHFTQAIHNTVFQVVLGYVELCAGNT
DTKFQKLQYKDLCTHVTPDSYIPCLADLCKALWEVMLSYYRTMEWHEKHDNEETAAAAEG
SNVMSTEEATFDRGYVKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIVS
RLMQVGEEFCGSKSEVLQESIRKQSVNYFKNHHRIRLDELRMFLENETWELCPVKSNFSI
LQLHEFKFLEQSRSPSVSPSKQPSATSSKPVTLFEQYCSGGNPFEIQADHKDEETEDVLA
SNGYESDEQEKSAYQDYDSDSDVPEELKRDYVDEQTGDVPVKSVSRETLKSRKKSDYSLN
KVNAPILTNTTLNVIRLVGKYMQMMNILKPIAFDVIHFMSQLFDYYLYAIYTFFGRNDSL
ESTGLGLSSSRLKTTLNRIQESLIDLEGSADPTATLTAAEERKEKVPSPHLNQLVILTSG
DTLYGLAERVVATESLVFLAEQFEFLQPHLDAVMPAVKKPFLQQFYSQTVSTASELRKPI
YWIVAGKAIDYEQMLLLMMNVKWDVKEIMSQHNIYVDALLKEFEQFNKRLNEVSKRVRIP
LPVSNILWEHCIRLANRTIVEGYANVKKCSNEGRALMQLDFQQFLMKLEKLTDIRPIPDK
EFVETYIKAYYLTENDMERWIKEHREYSTKQLTNLVNVCLGSHINKKARQKLLAAIDEID
RPKR
NT seq 2895 nt   +upstreamnt  +downstreamnt
atgcaaaaaatcaaatctctcatgacccggcagggtctgaagagccctccggagagcctc
aatgatcttggtgcctttgagagccttcgggtccctggaaaggaggaattcagggagctt
cgagaacagccaagcgaccctcaagctgagcaagagttgattaatagcattgaacaagtc
tatttttctgcggatccatttgatattgttaaatatgagctggagaagcttcctcctgtt
ctcaatctgcaagagttagaggagtacagagacaaattaaagcaacaacaatctgcagtc
tctaaaaaagtggcagatttgattcttgaaaagcagcctgcttatgtaaaggaacttgaa
agagtcacatcactgcagacaggtcttcagttggctgctgtcatctgcacaaatgggagg
aggcacttgaatattgcaaaggaaggttttactcaggctagcttaggccttcttgcaaat
caaaggaagcgtcagttgctaattggacttctgaagtcgctgagaaccataaaaacattg
caaagaactgacatacgcttaagtgaaatgctggaggaagaggactatccaggagctatt
cagctgtgcctagaatgtcagaaggctgccagcacttttaaacactacagctgtataagt
gagctgaattcaaagctgcaagatactttggagcaaattgaggaacagttggatgtagct
ctttccaaaatctgcaagaattttgacattaaccattataccaaggttcagcaagcttac
cggcttcttggaaaaacacagactgcgatggatcagcttcatatgcacttcactcaagcc
attcacaacaccgtatttcaggttgtgcttggctatgtggagctgtgtgcaggaaacacg
gatacaaaattccagaagcttcagtataaagatctctgtacgcatgtgacaccagacagc
tatattccatgcctggcagacctgtgcaaagcactgtgggaagtcatgctcagctactac
agaaccatggagtggcacgagaaacatgacaatgaggaaacagctgcagctgctgaagga
agcaatgtgatgagtactgaggaggccacttttgaccgtggctatgtaaagaagaagtta
gagcacggccttacccggatatggcaggatgttcaactaaaagtaaaaacctacttgctt
ggaactgatttatctatattcaaatatgatgatttcatctttgttctggatattgtcagc
aggttgatgcaagttggagaagaattttgtggtagcaagtctgaagttttgcaggagtcc
attagaaaacaaagtgtcaattacttcaagaaccaccataggatacgacttgatgaactg
agaatgttcttagagaatgagacatgggagctttgccctgttaagtcaaattttagcatc
ttgcagcttcatgagtttaaattcctggaacagtctcgctccccatcagtttcacctagt
aagcagccatcagcaacttcttcaaagcctgtgactttgtttgagcagtactgcagtggt
gggaatccatttgaaatacaagccgaccacaaagatgaagaaactgaagatgtcttagcc
tctaatgggtatgagtctgatgagcaagagaagagcgcctatcaggactatgacagtgac
agcgacgtccctgaggagctgaagcgggattacgtggacgagcagaccggcgacgtgccc
gtgaagagtgtttcccgagagaccctgaagagcaggaagaagtcggattacagtctaaac
aaagtgaatgcacccatcttaacaaacacaacactgaatgtaataaggcttgttggaaag
tacatgcagatgatgaacatccttaagccaatcgccttcgatgtgatccatttcatgtct
cagctctttgactattacttgtatgccatatataccttttttggtcggaatgattcattg
gaatcaacaggacttggccttagtagtagcagactaaaaacaactctaaacagaattcaa
gaaagccttattgacctggagggctcagctgatccaactgccactctcacagcagccgag
gaaagaaaggagaaggtacccagcccacacctcaatcagctagtgattttgacatctggg
gatacattgtatgggttggcagagagagtggtagccacagaatccttagtgttcttggct
gagcagtttgagttccttcagccacatttggatgctgtgatgcctgcagtcaaaaagccc
ttcctgcagcagttttactcccagacagtctcaactgccagtgaactgcgcaagcccatt
tactggattgtggctggtaaagctattgattatgaacagatgcttctcctaatgatgaat
gtgaagtgggatgtcaaagagatcatgtcacagcacaacatctatgtagatgcattgctg
aaggaatttgagcagtttaacaagcggttaaatgaagtttctaagagagttcggatacct
ctgcctgtatcaaatatactttgggagcattgtatacgattagctaacagaactattgtg
gaaggatacgccaatgtcaagaaatgcagtaatgaggggcgtgccttgatgcaattggat
tttcaacagtttttaatgaaactcgaaaaactaactgacattagacctattcctgataaa
gaatttgtggaaacgtatatcaaagcctactacctaactgagaatgacatggagcgttgg
atcaaagagcacagggaatactcaacgaagcagttgaccaacctggtgaatgtttgccta
ggatctcatatcaataagaaagcaagacagaagctcctagcagctatagatgagatagac
aggcctaaaagataa

DBGET integrated database retrieval system