KEGG   Mus musculus (house mouse): 73297
Entry
73297             CDS       T01002                                 
Symbol
Fundc2b, 1700034I23Rik
Name
(RefSeq) FUN14 domain containing 2B
  KO
K24308  FUN14 domain-containing protein 2
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73297 (Fundc2b)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    73297 (Fundc2b)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    73297 (Fundc2b)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    73297 (Fundc2b)
SSDB
Motif
Pfam: FUN14
Other DBs
NCBI-GeneID: 73297
NCBI-ProteinID: NP_082770
MGI: 1920547
Ensembl: ENSMUSG00000074619
Position
3:complement(40854631..40856936)
AA seq 184 aa
MTTNTSTTTTATVARSISSFTDPHHFPSHNHIIRMASASQGHFDAYEALDLTEFAKKQPW
WRKLFGQESRSAGEKYSVATQLLIGGVTGWCTGFIFQKVGKLAATAVGGGFFLLQLANHT
GYIKVDWSRVEKDMKKAKEQLTIRKSAQIPTEVKSKAEEVVCFVKKNVLVTGGFFGGFLL
GMAS
NT seq 555 nt   +upstreamnt  +downstreamnt
atgacaacgaacacatccaccaccacaaccgcaactgtggcacgctctatctcctccttt
acggaccctcatcatttcccctctcacaaccacattataaggatggcctcggccagtcaa
gggcattttgatgcttacgaggcactggatcttacagaatttgccaaaaaacagccttgg
tggcgcaagcttttcgggcaggagagtcggtctgcaggtgagaagtacagtgtggcaacc
cagctccttattggaggtgtcactggctggtgcactggcttcatattccagaaagttgga
aagctggctgccacagcagtgggagggggcttttttctcctccagcttgcaaaccacact
ggctacatcaaagttgactggagtcgagtagagaaggacatgaaaaaggccaaggagcag
ctgacaattcggaagagcgcccaaataccaactgaagtcaagagcaaagctgaggaggtg
gtgtgctttgtgaagaagaatgttttagtaactggaggattttttggaggctttctgctc
ggtatggcatcctaa

DBGET integrated database retrieval system