KEGG   Mus musculus (mouse): 73301
Entry
73301             CDS       T01002                                 

Symbol
Ttc29, 1700031F13Rik
Name
(RefSeq) tetratricopeptide repeat domain 29
  KO
K24937  tetratricopeptide repeat protein 29
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    73301 (Ttc29)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    73301 (Ttc29)
SSDB
Motif
Pfam: TPR_12 TPR_8 TPR_2 TPR_1 TPR_7 TPR_14 TPR_19 TPR_6 TPR_MalT ANAPC3 RPN7 TPR_10 TPR_16 Cohesin_load Fis1_TPR_C TPR_11 TPR_4
Other DBs
NCBI-GeneID: 73301
NCBI-ProteinID: NP_898919
MGI: 1920551
Ensembl: ENSMUSG00000037101
Vega: OTTMUSG00000031442
UniProt: E9QLU4
Position
8; 8 C1
AA seq 471 aa
MATFPPLPMTHTRLAILARQKLPCSSKKIPRAQLIKEKEDIDYYLEQNFKGLSKEEVAAH
RNSYKKSICVDMLRDGFHKSFTELFALMEQWDKLREAAKAQSLFWQQRPLEDQPDKLDNF
YHYLTRAEAAERKGYYEEVYNNLYALACYFDNSEDKWVRNHFYERCFNIAQLIKADGGKK
EAEAESHMGLLFEEEGELLKAAEHYEAFHELTHGRLWKDGTGQLLNLVACESLVRTYRLL
SDRMLENKDYKQAIKILIKASEIAREGNDRSMEGEASYYLGLAHLASGEYETALTVLNRY
SEISTSLDDDHGLGRAYEAIAKALQSQGETTEAINYLEKFVTIARNNLQSLDMIRACTML
GDIYNEKGQYSKASEYFQQAFSTAMELMKTALMDETKVHYGIARAHQMMLAMKGYIESAD
SNGLNCLLSWKETRTQIEYDPILGESRRATEDNIYQLPDAEEETRRSPENQ
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggctacctttcccccacttcccatgactcatacaaggcttgcgatcttagccaggcag
aagctaccatgctcttcaaaaaaaatcccaagggcccagttgatcaaagagaaagaggac
atagattattacctggaacagaatttcaaagggctgtcgaaagaagaggtggctgcccac
aggaactcatacaagaagagcatctgcgtggacatgctgcgagatgggttccacaagtcc
ttcaccgagctctttgcactgatggaacagtgggataagctccgggaagctgcgaaggca
cagtccctcttctggcagcagaggcctctggaggaccagccggacaagctagacaatttc
taccactacctgaccagggccgaggctgccgagaggaaaggatactatgaggaggtatat
aacaacctgtatgctctggcctgttatttcgataattctgaagacaagtgggtgaggaat
cacttctacgaacggtgttttaatattgctcagctgatcaaagctgacggcgggaagaaa
gaggcagaggccgagtcacacatgggacttcttttcgaggaagagggtgagctcctgaag
gctgcagagcactatgaagcattccatgaactgacacacggacggctctggaaggatggt
acgggccagcttctcaacttggtggcctgtgaaagtctcgtgaggacctacagattgctc
tcagacaggatgctggaaaacaaagactacaaacaggccatcaaaatcctaataaaagct
tctgaaatagccagagaaggcaatgacagaagcatggaaggggaggcttcttactacctg
ggcttggcccacttggcttctggagaatatgaaaccgcactaacagtgctgaatcggtac
agtgagatctccacaagtctggatgacgatcatggcctggggagagcctatgaggctatc
gccaaggccctgcagagccaaggggagacaacagaagcaattaattacctggagaagttc
gtgacaattgcaagaaacaacttgcaaagcctcgatatgattcgagcatgcacgatgctc
ggcgacatctacaatgaaaaggggcaatacagcaaggcttccgagtacttccaacaagct
ttcagcaccgcgatggagctcatgaaaacggcgctcatggatgaaaccaaagtccactat
gggatagccagagcgcaccagatgatgctggcgatgaagggttacatcgaatctgccgac
tcgaatggcctcaactgcctgctgtcctggaaggagactagaactcaaatcgagtacgac
ccgattctaggagagtctagaagagccacagaagataacatatatcaactcccagatgct
gaggaagaaacaagaaggtctccagaaaatcaataa

DBGET integrated database retrieval system