KEGG   Mus musculus (mouse): 73318Help
Entry
73318             CDS       T01002                                 

Gene name
Ube2d2b, 1700013N18Rik
Definition
(RefSeq) ubiquitin-conjugating enzyme E2D 2B
  KO
K06689  ubiquitin-conjugating enzyme E2 D [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    73318 (Ube2d2b)
   04120 Ubiquitin mediated proteolysis
    73318 (Ube2d2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    73318 (Ube2d2b)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     73318 (Ube2d2b)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   73318 (Ube2d2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con RWD Prok-E2_B UEV
Motif
Other DBs
NCBI-GeneID: 73318
NCBI-ProteinID: NP_001263326
MGI: 1920568
Ensembl: ENSMUSG00000063447
Vega: OTTMUSG00000023561
UniProt: Q6ZWY6
Position
5; 5 F
AA seq 147 aa AA seqDB search
MALKRIHKELNDLAQDPPAQCSAGPVGEDMFHWQATIMGPNDSPYQGGAFFLTIDFPTEY
PFKPPKVEFTTRIYHPNVNSNGSICLDILRSQWSPALTISKVLLSISSLLCDPNPDDPLV
PEIAQIYKTDRDKYNRTAREWTQKYAM
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggctctgaagagaatccacaaggaactgaacgacctggcccaggatcccccagcacag
tgttcagcaggtcctgtcggggaagatatgtttcactggcaagctacaatcatggggcca
aatgatagtccctatcagggcggagcatttttcttgacaattgatttcccaacagagtac
cccttcaaaccacctaaggttgaatttacaacaagaatttatcatccaaatgttaacagt
aacggcagtatttgtcttgatattcttcggtcacagtggtctccagcactaactatttcc
aaagtacttttgtccatcagttctctgttgtgtgaccccaatccagatgatcccttagtg
cctgagattgctcagatctacaaaacagatagagacaagtacaacagaacagctcgggaa
tggactcagaaatatgcgatgtga

DBGET integrated database retrieval system