KEGG   Mus musculus (house mouse): 73332
Entry
73332             CDS       T01002                                 
Symbol
Ccdc30, 1700001O02Rik, 1700041C02Rik, 1700111D19Rik, 4930445I03Rik
Name
(RefSeq) coiled-coil domain containing 30
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF4686 Plant_tran T7SS_ESX_EspC
Other DBs
NCBI-GeneID: 73332
NCBI-ProteinID: NP_083562
MGI: 1920582
Ensembl: ENSMUSG00000028637
UniProt: Q8BVF4 Q8BX48
Position
4:complement(119179665..119272718)
AA seq 654 aa
MCQEGLFRLALSSPRKQTACSLGERRTLAEALGLVDSTLESRRDPNSSLQKEFPQHQDED
QSRAAAPQDCLLRDVECIAQKLEASLEEIHRGAREPREEREQRTLGDALENARLEIEKLK
DNLMKLKESGTTDLQRAREHNQRLDEEILALRNRVRSLDSEKKVLGEMYLTSGEKTSCQH
QGELRELRQNLRRLQILCNSAEKELRYERGRSLDLKQHNSLLQEENIKIKIELKQAQEKL
LDNARLHSSLTAEWKHCQQKVKELELEGLRQTQSLKSQQGLQEKLAREKSKAAEAQEKIL
DLQQKLDHGRQVCLSDVCILRKKQLEEEIKEAKSIEARLQQQCQEEQQRRILLDQDINEL
QTQVRALQDKEEQQEAVNSQQQEALRKQLERERRKCEEYVKSNQELSEKLSNLQQEKEAL
WQEHGRFLEQLGDHVRNYKDKHHCHKAKLQKVKDRLTHELEIRNKRIKELEDETGKLQQK
IEMEKVFQGQIMAQNDILLLEKRKLLEQVTDQEELICSSKCTISAFQSKASLLDKENQQL
QENCLRLMQQIGLLEQIIRSIQIRREEETVITDNAAFEILKKILPLQNSSFSGTGFVLSA
ENLQETELHKWEGAAAIPKSPEPLSRSQDSESGYINVTSLKETHNTQGDQKPEL
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgtgtcaagaaggcttgttcagactagctctgagcagccccaggaaacagactgcatgc
tcactgggagagaggaggacgctggcagaggccctgggacttgtggactctacgctggag
tctcgaagagatccaaacagcagcctacaaaaagaatttccccagcatcaggatgaagac
cagagtagagctgcagcgcctcaggactgcctcctgagggatgtggagtgcatagcacag
aagctggaggcctcgctggaggagatccacaggggagcccgggagccacgggaggagaga
gaacagagaacgttaggtgatgcacttgagaatgcccgactggaaatagaaaaactgaaa
gataatctgatgaaattgaaagaaagtggtacaactgacctacagagagcaagggagcat
aaccagaggctggacgaggaaattctggcattaagaaaccgggttcgatcacttgactcg
gagaaaaaggtgcttggagaaatgtatctaacatctggagagaaaacaagctgccagcac
caaggggaactgcgggaactgcggcagaacctgcgccgcctgcagatcctgtgcaactcg
gctgagaaggagctgcggtacgagcggggccggagcctggacttgaaacaacataacagt
ttgctccaggaggagaacatcaagatcaaaattgaactcaagcaggcccaggagaagttg
ctggacaacgccaggctgcactcctcgctcactgcggagtggaagcactgtcagcagaaa
gtcaaggagctcgagctggaggggcttaggcagacgcagagccttaaatcccagcagggc
ctacaggaaaagctggcgcgggagaaatccaaagcagcagaagcacaggaaaagattttg
gacctgcagcaaaagctagaccacggaagacaagtctgcctctcagatgtttgcattttg
cgtaagaagcaacttgaggaagagattaaggaagcaaagagcatcgaggccaggctgcag
cagcagtgccaggaggagcagcagaggaggatcctcctagaccaggacataaatgagctc
cagacacaagtgagagccttgcaggataaggaggaacaacaggaagcagtcaattcccag
caacaagaggccctacgaaaacaactggagagggagaggagaaagtgtgaagagtatgtc
aagagcaaccaggaattgtcagagaaactatctaacttgcagcaagaaaaggaagctcta
tggcaagaacacgggcggtttttggagcaacttggtgatcatgtgagaaactacaaagac
aaacaccactgtcacaaagccaagcttcaaaaggtcaaggaccgtctaactcacgagcta
gagatacggaataagaggattaaagaacttgaagatgaaactggaaaactgcaacagaaa
attgaaatggagaaagtgttccagggtcagatcatggcccagaatgacatcctcctcctg
gaaaagaggaagcttctggaacaagtcacagatcaagaagaactgatttgcagcagcaag
tgcacgatatctgccttccagagcaaggcgtctttactggataaagaaaaccagcagttg
caggagaactgcctccggctcatgcagcaaattggcctcttggaacaaattataaggagc
atccagattcgcagagaagaggaaacagtaattactgacaacgctgcatttgaaatactc
aaaaagatactacctttacaaaactccagtttctcagggacaggcttcgtattgtcagct
gaaaatctccaggagactgagctgcacaaatgggaaggcgcagcagcaatccccaagtcc
cccgagcctctttcacgttcacaggattcagaaagtggatatataaatgtgacttctcta
aaagagacacacaacacacaaggggaccaaaagccagaactatga

DBGET integrated database retrieval system