KEGG   Mus musculus (mouse): 73341Help
Entry
73341             CDS       T01002                                 

Gene name
Arhgef6, 1600028C08Rik, 1700038J06Rik, 4930592P22Rik, alpha-PIX
Definition
(RefSeq) Rac/Cdc42 guanine nucleotide exchange factor (GEF) 6
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04810  Regulation of actin cytoskeleton
mmu05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    73341 (Arhgef6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    73341 (Arhgef6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73341 (Arhgef6)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    73341 (Arhgef6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF CH SH3_9 SH3_2 SH3_1 PH RhoGEF67_u1 CAMSAP_CH DUF2204 ZapB
Motif
Other DBs
NCBI-GeneID: 73341
NCBI-ProteinID: NP_690014
MGI: 1920591
Ensembl: ENSMUSG00000031133
Vega: OTTMUSG00000017820
UniProt: Q8K4I3 F6WMJ3
Structure
PDB: 

Position
X; X A6
AA seq 795 aa AA seqDB search
MQSRMWLSLHSCPESCSERPRASVMNPEERLVTWLISLGVLESPKKTVCDPEEFLKSSLK
NGVVLCKLINRLLPGSVEKYCLEPQTEADCIDNINDFLKGCATLQVEVFEPDDLYSGANF
SKVLNTLLAVNKATEDQLSERPCGRSSSLSAATSSQTNPQVAVPSTAPEQHSEEKAEMTE
NGSHQLIVKARFNFKQTNEDELSVCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREI
KPSERPLSPKAIKGFDTAPLTKNYYTVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNL
STVEFTCLLGNFEEVCTFQQTLCQALEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCAN
HPSAVNVLTQHSDDLERFMENQGASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDT
HPDHQDILKAIIAFKTLMGQCQDLRKRKQLELQILSEPIQAWEGDDIKTLGNVIFMSQVV
MQHGACEEKEERYFLLFSSVLIMLSASPRMSGFMYQGKIPIAGMVVNRLDEIEGSDCMFE
ITGSTVERIVVHCNNNQDFQEWMEQLNRLTKGPTSCGSLSKTSSSSCSTHSSFSSTGQPR
GPLEPPQIIKPWSLSCLRPAPPLRPSAALGYKERMSYILKESSKSPKTMKKFLHKRKTER
KASEEEYVIRKSTAALEEDAQILKVIEAYCTSASFQQGTRKDSVPQVLLPEEEKLIIEET
RSNGQTIIEEKSLVDTVYALKDEVKELKQENKKMKQCLEEELKSRKDLEKLVRKLLKQTD
ECIRSESSSKTSILQ
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcacggatgtggcttagtcttcacagctgccccgagagctgttcagagcgtccg
agagcctcagtcatgaatccagaagaacgccttgtgacatggcttatatctttgggagtt
ctagagtctcccaaaaagactgtctgtgatccagaggagttcttgaagtcctcgctgaaa
aatggggtagtgttgtgcaaactcataaacagacttctgcctggctcggtggagaagtat
tgtctggaaccccaaactgaggccgactgcatcgacaacatcaatgacttcctgaaagga
tgtgcaactcttcaagtggaagtgtttgagcctgatgacctctattcgggggccaatttc
tccaaggttctgaatactcttttagctgtcaacaaagcaactgaagatcagctctcagaa
agaccatgtggaaggtcctcttctcttagtgctgcgaccagctctcagacaaacccgcag
gtggccgttcccagcacagctccagagcagcacagcgaggaaaaggcagagatgacggaa
aatggaagtcaccagttgatagtaaaggcaagattcaacttcaagcagacgaatgaagat
gaattgtcagtgtgtaaaggggacatcatttatgtcacacgagttgaagaaggaggctgg
tgggaaggcacattaaatgggagaactggatggttccctagtaattatgtccgagaaatt
aaacccagtgagagacctctgtcccctaaggctatcaaaggatttgacactgctccactt
accaagaattactacactgtggtgttacagaacatcttggacactgaaaaagaatatgcc
aaagaacttcagtctcttcttgttacttacctaagacccttgcagtctaataacaacctg
agtactgtggagtttacatgtttattgggaaactttgaagaagtatgcacatttcaacag
acactctgccaagccttggaagaatgttcaaagtttccagaaaaccaacacaaagtagga
ggctgcctactgaacctcatgcctcatttcaaatcgatgtacctggcttactgtgcaaat
catccatcagctgtcaacgtgctcacccagcacagtgatgatctagaacgattcatggaa
aatcaaggtgcatccagcccgggtatcctcattctaacaacaagtctcagcaaaccattc
atgcgactggaaaagtatgttactctcttgcaagaactggaacgacatatggaggacact
catccagaccatcaggatattctgaaagcaatcatagcattcaaaacactcatggggcag
tgtcaagatctgagaaagagaaagcagctggaattgcagatcctttcagaacctattcag
gcatgggaaggagatgatattaagactttgggaaatgtgatctttatgtctcaagtagtg
atgcagcatggggcctgtgaggagaaagaggaacgatattttctgctgttttcaagtgtc
ttgataatgttgtctgcaagtcctcggatgagtggctttatgtatcagggaaaaatacca
atagcagggatggtagtgaacagattggatgaaattgaaggcagtgactgtatgttcgaa
atcacaggtagcacggttgagagaattgtggtccattgcaacaataaccaggacttccag
gagtggatggagcagctgaacagactgaccaaaggaccaacctcttgcggttcattgtct
aagacctcctcctcatcatgtagtactcattcttcttttagctctaccggacagccccga
ggacccttggagcctcctcaaattataaaaccgtggagtttaagttgcctacgacctgca
cctccacttagaccatcagcagcactaggttataaagagaggatgtcttatatcttaaag
gaatctagtaagagccccaaaacaatgaagaagtttcttcacaaaagaaagacggagagg
aaagcatccgaggaagaatacgtgattaggaaaagtactgctgccctggaagaggatgct
cagattcttaaggtgatcgaagcttattgcaccagcgccagttttcaacaaggtactcgt
aaagattctgttccacaagttctactccccgaggaagagaaactcattattgaagaaacc
agaagtaatgggcagaccatcattgaagagaagagccttgttgatactgtctatgccttg
aaggatgaggtcaaggaactgaagcaggagaataaaaaaatgaagcaatgtctggaagaa
gaattgaagtcgaggaaggacctagagaagctggtccggaagctgttgaaacaaacagat
gaatgcattcgatctgaatccagcagcaagacctcgattctccagtaa

DBGET integrated database retrieval system