KEGG   Mus musculus (mouse): 73368Help
Entry
73368             CDS       T01002                                 

Gene name
Col20a1, 1700051I12Rik
Definition
(RefSeq) collagen, type XX, alpha 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 VWA Collagen VWA_2 Pur_ac_phosph_N VWA_3 Interfer-bind DUF4959
Motif
Other DBs
NCBI-GeneID: 73368
NCBI-ProteinID: NP_082794
MGI: 1920618
Ensembl: ENSMUSG00000016356
Vega: OTTMUSG00000019845
UniProt: Q923P0
Position
2; 2 H4
AA seq 1320 aa AA seqDB search
MSLQGSYQHFCLWMFLGTTLALGQGQVSSRLRLAVLPEDQLQMKWREAEGSGLGFLVQVT
PMAGDLEQELILTTKTPKATVGGLNPSKSYTLQIFELTDSGPILLARREFVIEDLKSQSL
GRGSRRLAGATLEPTSLPLRGPDSEKTSEPSIAFTLSRDLPILDHPQFQCTPPTPADIIF
LVDGSWSIGHNHFQQVKDFLASIITQFAIGPDKVQVGLTQYSGDPQTEWDLNSFQTKEQV
LAAVHHLRYKGGNTFTGLALTHVLEQNLKPAAGVRPEAAKVLILVTDGKSQDDVRTAARI
LKDQDIDVFVVGVKNVDEAELKLLASQPLDITVHNVLDFPQLDTLAPLLSRLICQKIQGR
GPVKPAAGTRVLDPLPTPTRLILTHATSSSIHLSWTPALYPPLKYLIVWQPSRGGAPKEV
VVEGPVSSMELGNLTSSTEYLVSVLPVYESGVGKSLQGRATTAPLPPPGPLTLAAVTPRT
LHVTWPPSAGVTQYLVQYLLATSTGEEQKREVHVGQPEVLLDGLEPGQDYDVSVQSLRGP
EASEVQSIRARTSALGPPRHLTFSDVRYNSTCVSWEAQRPVRLVKVSYISSDGSHSGQTQ
VPGNLTSATLGPLSSSTMYTVRVTCFYLGGGSSVLTGHVTTQKAPSPGQLSVMELPGDAV
KLSWLATALSGVLVYQIKWMPLGEGKAREISVPGTLGTATLPGLMKHVEYEITILAYYRD
GTRSDPVSLRYTPSAASRSPPSSLALSSETPNSLQVNWTPPSGHVLHYRLNYTLASGSGP
EKSISVPGTRSHAVLRDLMSATKYRVLVSAVYRAGESMAVSATYRTAACPALHPDSSLSG
FDLMVAFGLVAKEYASIRGVAMEPSALGVVPTFTLFKDAQLMRRVSDIYPATLPPEHTIV
FLVRLLPETPREAFALWQMMAEDFQPILGVLLDAGRKSLTYFNHDSRAALQEVTFDLQDA
KKIFFGSFHKVHIAVGHSKVRLYVDCRKVAERPIGDAGSPPTGGFITLGRLAKARGPRSS
SATFQLQMLQIVCSDTWADKDRCCEIPALRDGETCPAFPSACAYSSETPGPPGPQGPPGL
PGRNGPPGQQGHPGPKGEPGPPGQTGPEGPGGQQGSPGTQGRAVQGPMGPPGAKGEKGDQ
GLSGLQGLSGQQGIPGKTGLQGPKGMRGLEGPAGLPGPPGPRGFQGLAGARGTNGERGAP
GAVGPTGLPGSKGERGEKGEPQSLATIFQLVSQACESAIRTHVLKLNSFLHENARPPMPF
MAETAKLGRPRSIDPGLHNEALLPGDWGHILRPEDQGEPVTISHTSNPRLQEVQTPESLE
NT seq 3963 nt NT seq  +upstreamnt  +downstreamnt
atgagcctccaaggctcctaccaacacttctgcctctggatgttcttgggcaccacgttg
gcactggggcagggacaagtaagtagccgcctgaggctggcagtactgcctgaggaccag
ctgcagatgaagtggagggaagcagagggaagtggccttggcttcttggtgcaggtgaca
cctatggcaggggacttggagcaggagctgatactgaccaccaagacccccaaggccact
gtgggtggcctgaacccttccaagagctacaccttgcagatctttgagctcactgactcg
gggcctatcctgctggcacgaagggagtttgtgattgaggatctgaagagccaatctttg
ggcagaggcagccggaggctggctggagccaccctggagcctacctccttgcctctgagg
ggcccagactctgagaaaacatctgagcccagcattgcctttaccttaagcagggacctg
cccattcttgatcacccccagttccaatgtacacccccaacacctgctgatataatcttc
ctggtggacgggtcctggagcatcggccacaaccacttccagcaggtgaaagacttcctg
gccagcatcatcacacaatttgcaataggaccagataaagtccaagtaggtctgacacag
tacagtggagacccccagaccgagtgggacctgaactccttccaaaccaaggagcaagtg
ctagcagctgtacaccacctccgctacaagggaggaaacacattcacaggccttgctcta
acccatgtgctggagcagaacctgaagccagcagccggtgtccgtccagaggcagccaaa
gtgttgattctggtgacagatggcaagtcccaggatgatgtgcgcacagctgccaggatc
cttaaggatcaggacattgatgtctttgttgtgggtgtgaagaatgtcgatgaggctgag
ctgaagctcctggcgtcccagccactggacatcactgtccacaacgtgctggacttccct
cagctggacaccctagctcctctgctcagccgactcatttgccaaaaaattcagggcaga
ggcccagtcaaaccagcagcaggtactcgggtcctggaccccctccccacgcccaccaga
ctgatcctgacccacgccacctcatccagtatccacctgtcttggactccagccttatac
ccacccctcaagtatctaattgtatggcagccttctaggggtggtgcccccaaggaggtg
gtggtggaggggcctgtctcatccatggagcttggaaacctgacctccagcacagaatac
ttggtctctgtgcttcctgtctatgagagtggggttggcaagagcctgcaaggccgggca
accacagcacccctgcctccacctgggccactgaccctagctgcagtgacacccagaact
ctccacgtcacctggccgccctctgctggggtcactcagtacttggtgcagtacttgctg
gctacctccactggggaggagcaaaagagagaggtacatgtgggacagcctgaggtactg
ctggatggtctggagcctggccaggactatgatgtctcagtgcagagccttcggggacca
gaggccagcgaggtccagagcatccgtgccaggacctctgccctggggcccccaagacac
ctgactttctcagatgttcgctacaactcaacctgtgtgtcctgggaagcccagaggcct
gtgcgcctggtcaaggtcagctacatctctagtgatggcagccactctgggcagactcag
gttcctgggaaccttacttcagctactctgggcccactttcttcctctaccatgtacacc
gtcagagtcacctgtttttaccttgggggtggttcctccgtgctgactggccatgtaacc
acacagaaagctcctagccctggccagctgtctgtgatggagctcccgggagatgcagta
aagctgtcatggctggccactgccttgtctggtgtacttgtttatcagatcaagtggatg
cccttgggagaagggaaggcccgtgagatctctgtcccagggacccttggcacagccacc
ttgcctggcctgatgaaacatgtggaatatgagatcaccatccttgcctactacagggac
ggcactcgcagcgaccccgtgtccctccgctacaccccctctgcagcaagcagaagcccc
ccatccagcctggccttgtcctcggagacccccaacagcctgcaggtcaactggacacca
ccaagtggccatgtcctccattaccggctcaactacacactggcctcaggctctggacca
gagaaatcgatctctgtaccaggcaccaggagccatgccgtgcttcgtgatctgatgtct
gccacgaagtacagggtcctggtctcagctgtctacagagcaggggagagcatggcagtg
tctgccacataccgcacagcagcctgcccagccctgcacccggacagttccctctcaggg
tttgacctgatggtggcctttggcctcgtggcaaaggagtatgcctctattcgaggagtt
gccatggagccctcagccttgggtgtggtcccaaccttcactctcttcaaggatgctcaa
ctgatgcgtcgggtcagtgacatctacccagcaaccctgccaccagaacacaccattgtc
ttccttgtgcgtctactccctgagacaccccgggaagcctttgcactgtggcagatgatg
gctgaagatttccagcccatcctcggggttctgctggatgctggcagaaagtctctgact
tacttcaaccatgattcccgggcagccttgcaggaggtcacctttgacctgcaggatgca
aagaagatcttctttggaagcttccacaaggtacatatagctgtaggccactctaaggtc
agactctatgtggactgtcggaaggtggccgagcgtcccattggggatgctggcagccca
cccacaggtggtttcatcacactagggaggctagccaaggccagagggccacggagcagc
tcagccacattccagctccagatgttgcaaatcgtgtgcagtgatacctgggcagacaag
gacaggtgttgtgagattcctgcactgagggatggagagacgtgcccggccttcccttca
gcctgtgcctactcatctgagacccctgggccaccagggccccaaggccctccgggtctc
cctggaaggaacggccctccaggacagcaggggcacccagggcccaagggggagccgggc
ccacctggacaaacaggacctgaaggccctggaggtcagcaggggtcaccagggacccag
ggccgcgcagtccagggacccatggggccaccaggagccaaaggagagaagggggatcag
ggactttcaggcttgcagggcctctctggccagcaaggcatccctgggaaaactggccta
cagggaccaaagggcatgagaggactggagggacctgctggcctgccaggaccacctggc
cccagggggttccagggcttggcaggggccaggggcaccaatggggagcgaggagcccca
ggagctgtgggtcccacaggtctaccagggtccaaaggtgaacgaggagagaagggagag
ccacagtcccttgccaccatcttccagctggtgagccaggcctgcgagtcagccatacgg
acacatgtgctgaagctgaattccttcctccatgagaatgcccgtcccccaatgcccttc
atggcagagacagctaagctaggcagacccagatctatagatcctggattacacaacgag
gctctacttcctggagactggggacatatcctccgccctgaggaccaaggtgagcctgtg
actatcagccacacaagcaaccctagactgcaggaggtgcagaccccagaatccctggag
tga

DBGET integrated database retrieval system