KEGG   Mus musculus (house mouse): 73385
Entry
73385             CDS       T01002                                 
Symbol
Fam177a, 1700047I17Rik, 1700047I17Rik1, C14orf24, D730001C10Rik, Fam177a1
Name
(RefSeq) family with sequence similarity 177, member A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: FAM177 PAF NAD_binding_4 Connexin
Other DBs
NCBI-GeneID: 73385
NCBI-ProteinID: NP_082803
MGI: 1920635
Ensembl: ENSMUSG00000095595
UniProt: Q8BR63
Position
12:55171313..55188889
AA seq 207 aa
MERESGCAAAGETEAAAATAFRDATRQISNERGFENVELGVMGKKKKVPRRVIHFVSGET
MEEYSTDEDEVDGLDKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVL
GISTPKYQYAIDEYYRMKKEEEEEEEENRMSEEAERQYQQNKLQADSIVQTDQPETVSSS
FVNINFEMEEDCEAIKENKQRPVSVPP
NT seq 624 nt   +upstreamnt  +downstreamnt
atggagcgtgagtcgggatgcgcggcggcgggagagaccgaggcagcggccgccacggcg
ttccgagacgcgacacggcagataagtaatgaaagaggatttgagaatgtagaactgggc
gtcatggggaagaagaagaaagtcccgaggagggtcatccactttgtcagtggagagaca
atggaggagtacagcaccgacgaggacgaggtggacggcctggacaagaaggacgtgctg
cccactgtcgacccgacaaaacttacctggggcccctacctatggttttacatgctgcgg
gccgccacatcaaccctctcagtgtgtgactttcttggagagaagattgcgtcagttttg
ggcatcagcaccccaaaataccagtacgccattgatgagtattaccggatgaagaaggag
gaggaggaggaggaagaagaaaataggatgtcagaagaagcagaaagacaataccaacaa
aacaagctgcaggccgattccattgtacagacagaccaaccagaaacagtgtcgtccagc
tttgtaaatattaattttgaaatggaggaagactgtgaagcaattaaggaaaacaaacag
cgtccagtctctgtcccaccatag

DBGET integrated database retrieval system