KEGG   Mus musculus (house mouse): 73407
Entry
73407             CDS       T01002                                 
Symbol
Tepp, 1700055M20Rik
Name
(RefSeq) testis, prostate and placenta expressed
  KO
K25742  testis, prostate and placenta-expressed protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    73407 (Tepp)
SSDB
Other DBs
NCBI-GeneID: 73407
NCBI-ProteinID: NP_955534
MGI: 1920657
Ensembl: ENSMUSG00000090206
UniProt: Q6IMH0
Position
8:96038148..96053239
AA seq 216 aa
MAQIIDLVPWDECSAHLYASPAVLLPLERVRHPLAGVKHQLYHPALPSLRRMDMDTVKGC
LSDEHCQSSTYFSKDDFNKAHFTLLGVPNKPLQCLDFTATGQKLCHKYRGGKMIPIAPGI
NRVDWPCFTRAIEDWSKFVSRSEEFKLPCANKRVEGFSGYAVRYLKPEVTQNWRYCLNQN
PSLDRYGQKPLPFDSLNAFRRFGSHYSRINYLTPWH
NT seq 651 nt   +upstreamnt  +downstreamnt
atggcccaaatcatagacctggtgccctgggacgaatgctccgcccacttgtatgcttcc
ccagcggtcctcctccccctggagcgagtgcgccacccactggccggtgtgaagcaccag
ctctaccacccggccttgccttcccttcggcgcatggatatggacactgtcaagggttgc
ctctccgatgaacactgccagtcttccacctacttctccaaagatgatttcaacaaggcc
cacttcacactcctaggggtccccaacaaacccctgcaatgcctggatttcacagcaacc
ggccagaagctctgtcacaagtatcgtggcggcaagatgattcccatcgcgccaggcatc
aaccgggtcgactggccctgcttcacgcgtgccatcgaagattggtctaaattcgtgtcc
aggtccgaagagttcaagctgccttgtgccaacaaaagggtggagggtttcagtggctac
gcggtgcggtacttgaagccggaggtgacccagaactggcggtactgcctcaaccagaac
cccagcctggaccgctacggacagaagcccctgcctttcgactcgctgaacgcgttcagg
cgctttggctcccactacagtcgcatcaactatctgactccctggcattaa

DBGET integrated database retrieval system