KEGG   Mus musculus (mouse): 73412
Entry
73412             CDS       T01002                                 

Symbol
Nme8, 1700056P15Rik, Sptrx-2, Txndc3
Name
(RefSeq) NME/NM23 family member 8
  KO
K19868  thioredoxin domain-containing protein 3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    73412 (Nme8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    73412 (Nme8)
SSDB
Motif
Pfam: NDK Thioredoxin Redoxin TRAPP
Other DBs
NCBI-GeneID: 73412
NCBI-ProteinID: NP_853622
MGI: 1920662
Ensembl: ENSMUSG00000041138
Vega: OTTMUSG00000024181
UniProt: Q715T0
Position
13:complement(19829248..19881996)
AA seq 586 aa
MASKKREVQLQSVVNSQNLWDEMLLNKGLTVIDVYQAWCGPCKAVQSLFRKLKNELNEDE
ILHFVVAEADNIVTLQPFRDKCEPVFLFSLNGKIIAKIQGANAPLINRKVITLIDEERKI
VAGEMDRPQYVEIPLVDAIDEEYGEVQYESAAEVYNMAIIKPDAVLMRKNIEVREKIAKE
GFVIEIQENLILPEEVVREFYTHIADQPDFEEFVVSMTNGLSCVLIVSQEDSEVIQEETL
PQTDTEEEPGVLEEPHVRFAPVMIKKKRDSLQEYMDRQHMSDYCDVEDDAVKVSKLIDIL
FPDFKTMKSTNVQTTLALLHPDICEEEKDDVLNVIHNEGFTILMQRQIVLSEEEARTVCK
IHENEEYFDNLIGHMTSNHSYVLALRRENGVEYWKTLIGPKTIEEAYASHPQSLCVQFAS
GNFPTNQFYGSSSKAAAEKEIAHFFPPQSTLALIKPHVTHKERMEILKTIKEAGFELTLM
KEMHLTPEHANKIYFKITGKDFYKNVLEVLSLGMSLVMVLTKWNAVAEWRRMVGPVDPEE
AKLLSPESLRAKYGLDILRNAVHGASNFSEASEIISNVFTEGNPEN
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggcaagcaaaaagcgtgaagtccagctacagtcagtcgtcaatagtcagaacttgtgg
gatgagatgttgctgaacaaaggcttaacagtgattgatgtttaccaagcctggtgtgga
ccttgcaaagccgtgcaaagtttattcagaaaactaaaaaatgaactgaacgaagatgag
attcttcacttcgtcgttgctgaagctgacaacattgtgactctccagccatttagagat
aaatgtgagcccgtgtttctctttagtcttaatggtaaaatcattgcaaagattcagggt
gcaaatgctccacttatcaatagaaaagtcattaccttgatagatgaagagaggaaaatt
gtagcaggtgaaatggatcgtcctcagtatgttgaaattccactagtagatgcaatcgat
gaagaatatggggaagtacagtatgaaagtgctgcggaagtttacaatatggcaattatc
aaacctgatgctgtactcatgagaaaaaatatagaagttagggaaaaaatagccaaagaa
ggatttgttatagaaatacaagaaaacctgattctccctgaagaggtagtgagggaattc
tacactcatatagcagaccagcctgactttgaagagtttgtcgtttctatgacaaatggc
ctcagctgtgtgctcattgtatctcaagaagactccgaggttattcaggaagaaactctc
ccgcagactgatacagaagaagaacctggcgttttggaagagcctcacgttaggtttgca
cctgtgatgataaagaagaaacgggacagtttgcaagagtatatggaccgacagcatatg
tctgattactgcgatgtcgaggacgatgcggttaaggtctctaagctcattgacatatta
ttccctgattttaaaactatgaaaagcacgaatgtacaaacgacgctagcattactgcat
ccagacatctgtgaggaagagaaagatgacgtgttgaacgttattcacaatgaagggttc
accatactgatgcagaggcaaatcgtattatcagaggaagaagcaagaacagtgtgcaag
atccatgaaaacgaagagtattttgataatcttatagggcacatgaccagtaatcactct
tatgtccttgctctacggagggaaaatggtgtggaatattggaaaacattaattgggcca
aaaacgattgaggaagcttatgcatctcatccacagagtttatgtgtacagtttgcttca
gggaattttcctaccaaccagttctacgggagcagttcaaaagcagcagctgagaaggaa
atagcgcatttcttccctccccagagcacacttgcattgatcaagcctcatgtgacacac
aaagaaagaatggagatcctgaagaccattaaagaggcaggatttgagctgaccctgatg
aaggaaatgcacctgactccagagcatgcaaacaaaatttatttcaaaataacaggaaaa
gatttttataaaaatgtattggaagtcttatctttgggcatgtcgctagtcatggttttg
accaagtggaatgctgttgcagaatggaggcgaatggttggcccagtagacccagaagaa
gcaaaactgctctccccagaatccctccgagccaaatatggactagacattttgagaaat
gctgtccatggggcgtctaacttttctgaagcatcagaaatcattagtaatgtgttcaca
gagggtaatcctgagaactag

DBGET integrated database retrieval system