KEGG   Mus musculus (mouse): 73419
Entry
73419             CDS       T01002                                 

Gene name
Armt1, 1700052N19Rik, AW320013, AW536799
Definition
(RefSeq) acidic residue methyltransferase 1
  KO
K23114  damage-control phosphatase, subfamily III [EC:3.1.3.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    73419 (Armt1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     73419 (Armt1)
SSDB
Motif
Pfam: DUF89
Other DBs
NCBI-GeneID: 73419
NCBI-ProteinID: NP_077223
MGI: 1920669
Ensembl: ENSMUSG00000061759
Vega: OTTMUSG00000030945
UniProt: A6H630
Position
10; 10 A1
AA seq 439 aa
MAESPAFLSAKDEGSFAYLTIKDRTPQILTKVIDTLHRHKSEFFEKHGEEGIEAEKKAIS
LLSKLRNELQTDKPITPLVDKCVDTHIWNQYLEYQRSLLNEGDGEPRWFFSPWLFVECYM
YRRIHEAIMQSPPIHDFDVFKESKEENFFESQGSIDALCSHLLQLKPVKGLREEQIQDEF
FKLLQISLWGNKCDLSLSGGESSSQKANIINCLQDLKPFILINDTESLWALLSKLKKTVE
TPVVRVDIVLDNSGFELITDLVLADFLFSSELATEIHFHGKSIPWFVSDVTEHDFNWIVE
HMKSSNLESMSTCGACWEAYARMGRWAYHDHAFWTLPHPYCVMPQVAPDLYAELQKAHLI
LFKGDLNYRKLMGDRKWKFTFPFHQALSGFHPAPLCSIRTLKCELQVGLQPGQAEQLTAS
DPHWLTTGRYGILQFDGPL
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgagtccccggcgtttctttccgctaaggacgaggggtcctttgcatatcttacg
attaaggacagaacaccgcagatcttaaccaaggttattgatacattgcatcgacataaa
agtgaattttttgaaaaacatggagaggaaggcattgaagctgaaaagaaagccatctct
cttctttctaaattacggaatgaactgcagacagacaaaccaatcacccccttggtggac
aagtgtgttgacacccacatatggaatcaatacctggagtatcagcggagccttttaaat
gaaggcgatggggagccacgctggttcttctcaccctggttgtttgtagagtgctacatg
tatcggagaattcatgaagccatcatgcagagtccgccaatccatgacttcgacgtgttt
aaggaaagcaaagaggagaacttcttcgagtcgcagggctccatcgatgctctgtgttca
cacctgctgcagctgaagcccgtcaaaggcctcagggaagagcagatccaggatgagttc
tttaaactcctgcagatttccctctgggggaataagtgtgatctgtctctctcaggtgga
gaaagtagttctcagaaggccaatataataaattgtttgcaagacctaaagccattcatt
ttgataaatgacacagaatctctctgggcattgctcagtaagttaaagaaaacagtagaa
acgcccgtagttagagtagacattgttctggataattctggctttgaactgattacggat
ttagtattggcggactttttattttcctcggagttagctactgagattcatttccatggg
aaaagcatcccatggtttgtgtctgacgttactgagcatgactttaattggatagttgag
cacatgaagagcagcaatctggagtccatgtccacctgtggggcctgctgggaggcctat
gctaggatggggaggtgggcttaccacgaccatgcattttggactctgcctcatccatat
tgtgtgatgccccaggtcgcccctgacttatacgctgaactgcaaaaggcacatcttatt
ttattcaagggagatttgaattataggaagctgatgggtgacagaaaatggaagttcacc
tttccgttccatcaggctctgagtggcttccaccctgcacctctctgtagcataaggaca
ttaaagtgcgagcttcaggttggtctgcagcctgggcaggcggagcagctcacggcctct
gatccccactggctgaccactggcaggtatggaatattgcagtttgatgggccactttga

DBGET integrated database retrieval system