KEGG   Mus musculus (house mouse): 73449
Entry
73449             CDS       T01002                                 
Symbol
1700066B19Rik, SMIM33
Name
(RefSeq) RIKEN cDNA 1700066B19 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF5527 CopC m04gp34like
Other DBs
NCBI-GeneID: 73449
NCBI-ProteinID: NP_001028340
MGI: 1920699
Ensembl: ENSMUSG00000073598
UniProt: Q3TS39
Position
18:35859895..35863922
AA seq 127 aa
MHQDDYYPQPSLLVNGSLDQEPQRQLPDMPPRGGDGLPLLAAIIAAFVLLAICIVLAVHF
GPALHQGQATLLTEPPALKPENGVYLIHWRLLSLQDSHRESQQGLFIPHSGPALDGHRPS
IDEVTYL
NT seq 384 nt   +upstreamnt  +downstreamnt
atgcaccaggatgactactaccctcagccttctctacttgtgaatggttcgttggatcag
gagcctcaaaggcagctcccagatatgccccctcgaggtggcgacgggctgccgctgctt
gctgccatcatcgcggcctttgtcctgctggcgatctgcattgtgctggcggttcacttt
gggcctgcactgcatcagggtcaggctactctcctcacagagccaccggccctaaagcca
gagaacggcgtttacctcatccactggcggctactgagtctacaggacagtcacagagaa
agccagcagggactttttattcctcactctggccctgccctagacgggcacaggcccagc
atcgatgaagtcacgtatctgtaa

DBGET integrated database retrieval system