KEGG   Mus musculus (mouse): 73466Help
Entry
73466             CDS       T01002                                 

Gene name
Ms4a13, 1700060E18Rik, Tetm4.2
Definition
(RefSeq) membrane-spanning 4-domains, subfamily A, member 13
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: CD20 DUF981
Motif
Other DBs
NCBI-GeneID: 73466
NCBI-ProteinID: NP_937867
MGI: 1920716
Ensembl: ENSMUSG00000057240
Vega: OTTMUSG00000047039
UniProt: Q5FWC3
Position
19; 19 A
AA seq 203 aa AA seqDB search
MECRNPKVSSANITVLGVIQIMIGIYHVLMWYFLLLLYMGQIKGVFGTYEPVTYKMGTSL
WGFAFVISGAFTVKAAKYQSRHMILCTMSLNILCIIITIVAASLTIVELSHFRSVSYRNY
GQAKLGREVSRVLLCSYPLEFAIALLYSISSCAYLPLSSIVKSLVRKTWRLSSLAAWRQM
IWLEAGNQEETLESVTEVVEGNS
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaatgtagaaatccaaaagtatcttcagcaaatattactgttttaggggttatccag
attatgattggaatctatcatgtactcatgtggtatttcctattgctgttgtatatggga
caaattaaaggagtatttggaacatatgaacctgtaacttacaaaatgggaacttcttta
tggggatttgcttttgtcatttcaggggccttcactgtaaaagcagcaaaatatcaaagt
agacatatgattctctgtactatgtccctgaacatactctgcataattattacgatcgtt
gcagccagcctaacaatagtggaattgtctcatttccgttcggtgtcatatagaaattat
ggacaagcaaagctgggaagggaagtgtcccgtgttttgttgtgctcctaccccctggaa
ttcgccattgccctcttgtactcaatctctagttgtgcatatttgcccttaagttcaatt
gtgaagtcattggtgaggaaaacttggaggctcagcagccttgctgcttggagacagatg
atttggcttgaggccggaaaccaagaggaaactttagaaagtgttactgaagtagtggaa
ggcaactcctga

DBGET integrated database retrieval system