KEGG   Mus musculus (house mouse): 73467
Entry
73467             CDS       T01002                                 
Symbol
1700066M21Rik, AI428479
Name
(RefSeq) RIKEN cDNA 1700066M21 gene
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: C2orf69
Other DBs
NCBI-GeneID: 73467
NCBI-ProteinID: NP_082822
MGI: 1920717
Ensembl: ENSMUSG00000038323
UniProt: Q9D9H8
Position
1:57416755..57424587
AA seq 365 aa
MLGSRRLRSPALVLLLLRPLLASGDSASRLQTRAMNPGGGERGSPEDSHRLQRSTVPGSD
PQRSNELLLLTSREGDSPEQRHHVLYFPGDVQNYHEIMTRHPENYQWENWSLENIATILA
RRFPNSYIWVIKCSRMHLHKFSCYDNFVKSNMFGAPEHTPDFGAFKHLYMLLVNAFNLTQ
NGMLFKNRSVWNKDCKASNCESNPSTSNGGQKENERTCEHVDEPSMSFPPLSLDGASFTL
IGFSKGCVVLNQLLFELKEAKKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLEEF
AQTGITVHTHVTPYQVHDPMRSWIGKEHKKFVQILRDLGMQVTSQIHFAKETPSIENHFR
VHEVF
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctggggtcgcggcgtctgcggtcccccgcgctggtgctgctgctgctgcggccgctg
ctcgcttccggagactccgcgtcccgcctgcagacccgagccatgaacccgggcggcggt
gagcggggctccccggaggacagccaccgtctgcagcgctccacggtgccgggctccgac
ccgcagcgcagcaacgaactgctcctgctgacatcccgggaaggagattccccggagcag
cggcaccacgtcctctacttccctggggacgtgcagaattaccatgagattatgactcgt
catcctgagaattatcaatgggaaaattggagtctagaaaacattgctaccattttagcc
cgccgttttcccaatagttatatttgggtaataaagtgttcccgaatgcatttgcacaaa
ttcagctgctatgacaattttgtgaaaagcaacatgtttggtgcaccagaacatactccg
gactttggagcctttaagcacttgtatatgttattagttaatgcttttaacctgactcag
aacggtatgctgttcaagaacaggagtgtttggaataaggattgtaaagcatctaactgt
gagtctaatccttctactagtaatggtggccaaaaggaaaacgagaggacctgtgagcat
gttgatgagccttccatgagttttcctccactgtcattggatggtgcatcgtttactttg
attggattcagtaaaggctgtgttgttttgaatcagttgctgtttgagttgaaggaagcc
aagaaagacaagaacatagatgcattcatcaaaagcataagaacaatgtactggctagat
ggtgggcattctggaggaagcaatacgtgggtcacatatccagaagtcttggaagaattt
gctcaaacaggaattactgttcacactcatgtaacaccttaccaagtacatgatccaatg
agatcctggattggaaaggagcacaagaaatttgttcagatactcagggatttgggtatg
caagtgaccagccaaattcattttgcgaaggaaactccttccatagagaatcatttcagg
gttcacgaagtattctga

DBGET integrated database retrieval system