KEGG   Mus musculus (house mouse): 73481
Entry
73481             CDS       T01002                                 
Symbol
Prss59, 1700074P13Rik, AV047902, Tryx5
Name
(RefSeq) protease, serine 59
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Other DBs
NCBI-GeneID: 73481
NCBI-ProteinID: NP_001348859
MGI: 1920731
Ensembl: ENSMUSG00000029883
Position
6:complement(40897371..40917975)
AA seq 251 aa
MKTFFIFTLLSLAVANTPKAVLKEYNNSEEYLPENFNVPYMVYLQSSPEPCVGTLIDPQW
VLTAAHCSLPTKIRLGVYRPNIKNEKEQICNYSFTVVHPNFDAKLLKNDLMLIKLSYPAT
INMYVGTIAIAMEPMAFNESCFIPTWTWNNYKNLSDPDILTWINEYSLSPSDCLDTLHQQ
KQETRINIMCIGHSLNAMSATKEVSAAPAICSGRVHGILSWGKASVANGSKGFFTEIHPY
ARWILKMIRSH
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaagacttttttcatcttcactctcttaagtctcgcagtagctaatactcccaaagcc
gttctgaaagaatataacaattcagaagaatacttaccagagaattttaatgttccttat
atggtctatctgcagtccagcccagagccttgtgttgggactctcattgaccctcagtgg
gtgctcaccgctgctcattgttctttaccaactaaaatccgactgggagtttaccgaccc
aacatcaaaaatgagaaagaacagatatgtaattactcattcactgtagtccatcctaat
tttgatgcaaaattactgaaaaatgacttgatgctgataaaactctcatatcctgctact
atcaacatgtatgtgggaactatagccatagctatggaaccaatggcatttaatgaatcc
tgcttcataccaacatggacctggaataactacaaaaaccttagtgatcctgacatcttg
acatggataaatgagtattctctttccccaagtgactgtttggacactcttcatcaacag
aaacaagaaacaagaataaacattatgtgcataggacattcacttaatgctatgtctgca
actaaggaagtatcagctgctccagccatctgcagtgggagggtgcatggaatattgtcc
tgggggaaagcaagtgtagccaatggaagcaaaggcttcttcactgaaattcatccctat
gcaagatggatcttaaaaatgatacgatcacactga

DBGET integrated database retrieval system