KEGG   Mus musculus (house mouse): 73495
Entry
73495             CDS       T01002                                 
Symbol
Samt3, 1700072E05Rik
Name
(RefSeq) spermatogenesis associated multipass transmembrane protein 3
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Claudin_2
Other DBs
NCBI-GeneID: 73495
NCBI-ProteinID: NP_082830
MGI: 1920745
Ensembl: ENSMUSG00000035454
UniProt: A2ARK7 Q9D9H1
Position
X:85087805..85090919
AA seq 233 aa
MNFLTCDIQRFAVSKEYIFRLSGLICSLTAVVFEIILANSRCWRLWEFDDKTVQFVFFGL
WEAYYHQVFNISGSTTRTLVHSPINSTWTISPEFHYAQTLIVWAILLKPVVLLFNAMAVK
IDYTNDSFVKGQMLLYKISASLLCISSLCTFVSVSWNHVVDLYGQTTLDFPPSFPVKKKD
LKMKHYTAAFPIGVLTATMSLFGVIIFLFEMSSLDPQSEVEAQCASRLINQKT
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaatttcctcacctgcgatatacaaagatttgctgtgtcaaaggaatatatcttcaga
ctgagtggactcatttgcagcctaacagctgtggtgtttgaaataatccttgcaaacagc
cgatgctggcgcctatgggaatttgacgataagactgtacagttcgtgttttttggactc
tgggaagcttattaccatcaagtgtttaacatctctggatctaccacccggactctggtg
cacagccctatcaactctacatggactatttcacctgaattccactatgcacagacattg
atagtatgggcgattttgttgaaacctgtagtcctactttttaatgcaatggccgttaag
atagactacacgaatgactcgtttgttaagggacagatgcttttgtacaagatctctgcc
tcacttttgtgtattagcagcctttgcacatttgtttccgtgagctggaaccatgttgta
gacctttacggccaaaccacacttgattttccacccagctttcctgttaagaaaaaggat
cttaaaatgaaacactatactgctgcattcccaataggggtcctgacagctaccatgtca
ctctttggtgtgattatattcctctttgagatgagctctttggatccacagagtgaagtg
gaggcccagtgtgcttccagactgatcaatcaaaagacatga

DBGET integrated database retrieval system