KEGG   Mus musculus (house mouse): 73523
Entry
73523             CDS       T01002                                 
Symbol
Pebp4, PEBP-4
Name
(RefSeq) phosphatidylethanolamine binding protein 4
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: PBP DUF2958
Other DBs
NCBI-GeneID: 73523
NCBI-ProteinID: NP_082836
MGI: 1920773
Ensembl: ENSMUSG00000022085
UniProt: Q9D9G2 Q9D9L9
Position
14:70077856..70297367
AA seq 242 aa
MTMKLVAAALCLSLLAAGLWVGLSLTAESIEEGKPGGEKPGGGKPGGSGRGCFLPPLPKE
DVSLCRNLEVFYMEMGNISCKIVPKCNLYRQKITAWQAPIVKFHTALDGALYLLVMVDPD
APSRSNPVMKYWRHWLVSNITGADMKSGSIRGNVLSDYSPPTPPPETGLHRYQFFVYLQG
DRDISLSVEEKADLGGWNLDKFLQQYGLRDPDTSTQFMTQFDEELSSEFGRINDDQEQFN
QK
NT seq 729 nt   +upstreamnt  +downstreamnt
atgacaatgaagctggtcgcagcagcactttgcttgagcctccttgcagccggcctgtgg
gtgggcctctcattgacagctgagtccattgaagaagggaaacctggaggagagaaacct
ggaggagggaaacctggaggcagcggacgaggatgttttctcccaccactgccaaaagaa
gatgtttcactatgcaggaacctagaagttttctacatggagatggggaacatcagctgt
aaaattgttcctaagtgcaatctatacagacagaagatcacggcctggcaggcgccgata
gtcaagttccacacggctttggatggtgcgctgtacctgctggtaatggtggatccagat
gcccccagcaggtctaaccccgtgatgaaatactggagacactggttggtgtccaacatc
acaggtgctgacatgaaaagtgggagtatccgtggcaatgtactatcagactactcgccg
cctaccccaccgccagaaactggtctacaccgctaccagttctttgtctaccttcaggga
gacagagacatttctctctcagtggaagaaaaggcagacttaggtggttggaatctggac
aaattcctgcagcaatatgggctgagagatcccgacacaagcacccagttcatgactcag
tttgacgaggaactgtcatcagagtttggtagaattaacgacgatcaagagcaattcaat
caaaaataa

DBGET integrated database retrieval system