KEGG   Mus musculus (house mouse): 73647
Entry
73647             CDS       T01002                                 
Symbol
Capn9, 2200003B16Rik, GC36, nCL-4, nCL4
Name
(RefSeq) calpain 9
  KO
K08578  calpain-9 [EC:3.4.22.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    73647 (Capn9)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C2: calpain family
   73647 (Capn9)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 CAPN13-like_C_EFh EF-hand_4
Other DBs
NCBI-GeneID: 73647
NCBI-ProteinID: NP_076198
MGI: 1920897
Ensembl: ENSMUSG00000031981
Position
8:125301361..125345470
AA seq 690 aa
MPYLHRSLRPQPQPVPGDARTIHSSGQSFEQLRQGCLQSGTLFEDADFPASNVSLFYSER
PQVPFVWKRPGEIVEKPEFILGGATRTDICQGELGDCWLLAAIASLTLNQKALTRVVPQD
QGFGSGYAGIFHFQFWQHSEWLDVVIDDRLPTFKDRLVFLHSADHNEFWSALLEKAYAKL
NGSYEALKGGSAIEAMEDFTGGVAENFQIREAPEDFFEILEKALKRGSLLGCSIDTLNAS
ESEARTSLGLIKGHAYTVTGLDQVNFHGQRIKLIRVRNPWGQVEWNGPWSDSSPEWRSVD
LEEQKRLGHTALDDGEFWMAFKDFKIHFDKVEICNLTPDALEDSALHRWEVTIHQGSWVR
GSTAGGCRNFLDTFWTNPQIKLSLTERDEGQEGCTFLAALMQKDRRRLKRFGANMLTIGY
AIYQCPDKDGHLSRDFFRYHASLARSKTFINLREVSERFQLPPGDYILIPSTFEPHQEAD
FCLRIFSEKRAVTRDLDENIDIDLPELPKPTPQEEETEEEQQFRALFQRVAGEDMEVSAE
ELEYVLNAVLQKKTALKFKRLSLLSCRNIISLMDTSGNGKLEFEEFRVFWDKLKHWMDLF
LQFDVDKSGTMSSYELRTALKAAGFQLGGHLLQLIVLRYADEDLQLDFDDYLNCLVRLEN
ASRVFQSLSVKNKDFIHLNINEFISLTMNI
NT seq 2073 nt   +upstreamnt  +downstreamnt
atgccttacctgcatcggtccctgaggccacagccacagccagtccccggggatgccagg
actatccactcctcaggtcagagctttgagcagctgaggcagggctgcctgcagtctggc
accttgtttgaggatgctgacttccctgccagcaatgtctccctgttctacagcgagagg
ccccaggtcccctttgtgtggaaacggccaggggaaattgtggaaaaaccagaattcatt
cttggaggggccaccaggaccgacatttgccaaggggagctgggagactgctggctcctg
gcggccattgcctccctaaccctcaatcagaaagcactgaccagggtggttccccaggac
caaggatttggttctggctatgccgggatatttcatttccagttctggcagcacagtgag
tggctggacgtagtgattgatgaccgcctgcccaccttcaaggaccgcctggtcttcctc
cactctgctgatcacaatgagttctggagcgcactgctggagaaagcctatgccaagctt
aacgggagttatgaggcactgaagggaggcagtgccattgaagccatggaagacttcact
gggggtgtggctgagaacttccaaatccgagaggcaccagaggatttctttgagattctg
gagaaggctttgaagcgtggttccttgctgggatgctccatagataccctgaatgcctca
gaatctgaagctcgaacatctcttggtctcattaagggccatgcctacaccgtgacgggg
ctcgatcaggtaaacttccatggccagagaatcaagctcatcagagtccgtaacccttgg
ggccaggtggagtggaacgggccatggagtgacagctctcctgagtggcgctctgtggac
ctggaggagcagaagcgcctgggccacactgcccttgatgacggggagttctggatggca
ttcaaagacttcaagatccattttgacaaagtggagatctgcaacctcacacctgatgcc
ctggaggacagcgccctccacaggtgggaggtgaccatccaccaaggaagctgggtccgt
ggctccactgctggtggctgtcgcaacttcctggacaccttctggaccaaccctcagata
aagctgtccctgaccgagagggacgagggccaggagggctgcactttcctagcagccttg
atgcagaaagaccgcaggaggctcaagaggtttggcgccaacatgctgaccattggctac
gccatttaccagtgcccagacaaggacggacacctgagtagggactttttcaggtaccat
gcctccctggcccgaagcaagacgttcatcaacttgagagaagtctcagagcgattccag
ctgcccccgggagactatatcctcatccccagcacctttgagccgcatcaggaggccgac
ttctgcctgagaatcttctctgagaagagagctgtgactcgggacctggacgagaacata
gacattgaccttcctgagcttccaaagccgactccacaggaggaggaaacagaagaggaa
cagcagttccgggccctgttccagcgagttgctggcgaggacatggaggtgtcagctgag
gagcttgaatatgttctaaatgctgttctgcagaagaaaacagccctcaagttcaagagg
ctgagcctgctgtcctgcagaaacatcatctctctgatggataccagtggcaacgggaag
ctggagtttgaagagttccgggtcttctgggacaagctgaaacactggatggacctgttt
ctccagttcgatgtggacaagtctggcaccatgtcttcctatgagctgcggacggcactg
aaagctgcaggctttcagctgggtggccatctcctgcagctgattgtcctcaggtatgca
gatgaggacctccagctggatttcgatgactacctcaactgcctggtgcggctggagaat
gcaagccgggtgttccaatctctcagtgtgaagaacaaggacttcatccatctcaacata
aacgagttcatcagcctgaccatgaacatctga

DBGET integrated database retrieval system