KEGG   Mus musculus (mouse): 73649Help
Entry
73649             CDS       T01002                                 

Gene name
Cybrd1, 2210407P13Rik, Dcytb
Definition
(RefSeq) cytochrome b reductase 1
  KO
K08370  cytochrome b reductase 1 [EC:7.2.1.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    73649 (Cybrd1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    73649 (Cybrd1)
Enzymes [BR:mmu01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.1  Linked to oxidoreductase reactions
    7.2.1.3  ascorbate ferrireductase (transmembrane)
     73649 (Cybrd1)
Transporters [BR:mmu02000]
 Other transporters
  Transmembrane electron carriers [TC:5]
   73649 (Cybrd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_B561
Motif
Other DBs
NCBI-GeneID: 73649
NCBI-ProteinID: NP_082869
MGI: 2654575
Ensembl: ENSMUSG00000027015
Vega: OTTMUSG00000013155
UniProt: Q925G2
Position
2; 2 C2
AA seq 290 aa AA seqDB search
MAMEGYRGFLGLLVSALLVGFLSVIFVLIWVLHFREGLGWNGSGLEFNWHPVLAVTGFVF
IQGIAIIVYRLPWTWKCSKLLMKSIHAGLNAVAAILAIISVVAVFEYHNVQKVPHMYSLH
SWVGLTALILYIQQLVVGFFVFLLPWAPPSLRAIVMPIHVYSGLLLFGTVIATVLMGVTE
KLFFVLKHPSYHSFPPEGVFTNTLGLLILVFGALIFWIVTRPQWKRPREPGSVPLQLNGG
NAECRMEGAIAISSAHSMDAADPADAESSSEGAARKRTLGLADSGQRSTM
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggccatggagggctaccggggcttcctggggctgctggtgtccgcgctgctcgtgggc
ttcctgtcggtgatcttcgtgctcatctgggtcctgcacttccgagaggggcttggctgg
aacggcagcgggctcgagtttaactggcacccggtgctcgcggtgaccggcttcgtcttc
atccagggcatcgccatcatcgtgtacagactgccatggacctggaagtgcagcaagctc
ttgatgaaatccatccatgccgggttaaacgctgtggctgccatcctcgccatcatctcc
gtggtggctgtgtttgagtaccacaatgtccaaaaagtcccccacatgtacagcctgcac
agctgggttggactgacagctctcatactctacatccaacagcttgttgtaggctttttc
gtctttctgcttccatgggctccgccctctctccgggcaatcgtcatgcccatacacgtg
tattctggactcctcctcttcggaacagtgattgcgacggttctcatgggagtgacagaa
aagctgttctttgtcctgaaacacccctcgtaccattcattcccaccagaaggtgttttt
acaaatacgctgggccttctgattctggtgtttggagccctcatcttttggattgtcacc
aggccccaatggaaacgccctagagaaccaggctctgtccctctccagctaaatggaggc
aatgcagaatgcagaatggaaggcgccatagcaataagctccgcccacagtatggacgca
gctgacccagctgacgcagagtcaagcagtgagggagcagcccggaagagaaccctcggc
cttgctgactctggccagaggtccaccatgtga

DBGET integrated database retrieval system