KEGG   Mus musculus (mouse): 73660Help
Entry
73660             CDS       T01002                                 

Gene name
Cabp4, 2410038D05Rik
Definition
(RefSeq) calcium binding protein 4
  KO
K23531  calcium-binding protein 1/2/4/5
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73660 (Cabp4)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    73660 (Cabp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5 EF-hand_9 SPARC_Ca_bdg EF-hand_4 DUF5580 DUF4551
Motif
Other DBs
NCBI-GeneID: 73660
NCBI-ProteinID: NP_653115
MGI: 1920910
Ensembl: ENSMUSG00000024842
UniProt: Q8VHC5
Structure
PDB: 

Position
19; 19 A
AA seq 271 aa AA seqDB search
MATEHNVQLVPGSQKIPKGVVSPRSAAEGPALTRRRSKKESWHPGSQKASSGDQSSSQGS
EASGSSKHPPRTKVGQEEPSSAPARPASHRHSHRHRSDPQQDAAQRTYGPLLNRMFGKDR
ELGPEELEELQAAFEEFDTDQDGYIGYRELGDCMRTLGYMPTEMELLEVSQHVKMRMGGF
VDFEEFVELISPKLREETAHMLGVRELRIAFREFDKDRDGRITVAELRQAAPALLGEPLE
GTELDEMLREMDLNGDGTIDFDEFVMMLSTG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagagcacaatgtacagctggttcctggctcccagaagatccctaaaggagtt
gtatctcccaggagtgctgctgagggccctgccttgaccaggagaaggagcaagaaggag
agttggcacccagggtcccagaaagccagttctggggaccagtcctctagccagggctct
gaggcctcaggaagcagcaagcaccccccaaggaccaaagtggggcaggaggaaccatcc
tcagcccccgccaggccagcgtctcaccgacactcccatcgacaccgttctgacccccag
caggatgctgcccaaaggacttatgggcccttgctcaaccgcatgtttggaaaggatcgt
gaactgggccctgaggagttggaggagctccaggctgcctttgaggagtttgacactgac
caggacggctacatcggctaccgcgagctaggtgactgcatgcggacgctgggctacatg
cccacggagatggagcttctagaagtgtcgcagcacgtgaagatgcgcatgggaggcttt
gtggattttgaagagtttgtggagctgataagcccaaagctgagggaggagacagctcac
atgctgggcgttcgggagctacgcatcgccttccgagagtttgacaaggacagggatgga
cggatcacggtggcggagctgcggcaggcagcaccagctctgctgggggaaccactagag
ggcactgaactggatgagatgttgcgagaaatggacctcaatggggatggcaccatagac
tttgacgagtttgtaatgatgctatctacaggctga

DBGET integrated database retrieval system