KEGG   Mus musculus (house mouse): 73666
Entry
73666             CDS       T01002                                 
Symbol
Thoc3, 2410044K02Rik, AL033344
Name
(RefSeq) THO complex 3
  KO
K12880  THO complex subunit 3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03013  Nucleocytoplasmic transport
mmu03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    73666 (Thoc3)
  09122 Translation
   03013 Nucleocytoplasmic transport
    73666 (Thoc3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    73666 (Thoc3)
   03041 Spliceosome [BR:mmu03041]
    73666 (Thoc3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     73666 (Thoc3)
Spliceosome [BR:mmu03041]
 Complex C
  Other components
   EJC/TREX
    73666 (Thoc3)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    73666 (Thoc3)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 eIF2A NBCH_WD40 PD40 Coatomer_WDAD Nup160 Cytochrom_D1 IKI3 Peptidase_S9_N WDCP DPPIV_N
Other DBs
NCBI-GeneID: 73666
NCBI-ProteinID: NP_082873
MGI: 1920916
Ensembl: ENSMUSG00000025872
UniProt: Q8VE80
Position
13:complement(54606650..54616653)
AA seq 351 aa
MAAPAAVLGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFPAHSAKVHS
VAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASG
DKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQ
FKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFA
TGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDK
LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcggcgcccgctgcggtcctgggcccctcggccctcggccagagcggccccggctcg
atggcgccctggtgctcagtgagcagtggcccgtctcgttacgtgctcgggatgcaggag
ctcttccgaggccacagcaagacgcgcgaattcccggcgcacagtgctaaggtgcactcg
gtcgcctggagctgcgatggccgtcgcttggcctcggggtccttcgacaagactgccagc
gtgttcttgctggagaaggaccggctggtcaaagaaaacaactaccggggccacggagat
agtgtggaccagctttgttggcacccaagcaaccctgacctctttgtcaccgcatctgga
gataaaaccattcgcatctgggatgtgaggactacaaaatgcatcgccactgtgaatacg
aaaggggagaacattaacatctgttggagtcccgacgggcagaccatcgctgtgggcaac
aaggacgacgttgtgactttcattgacgccaagacacaccgctccaaagcggaggagcag
ttcaagtttgaggtcaatgagatctcatggaacaacgacaacaacatgttcttcctgacc
aacggcaatggttgcatcaacatcctcagctacccagaattgaagcctgtgcagtccatc
aatgcccatccttctaactgcatctgtatcaagtttgaccccatggggaaatactttgcc
acaggaagtgcagatgccttggtcagcctttgggacgttgacgagttagtgtgcgtgcgg
tgcttttccagactagattggcctgtgaggaccctcagttttagccacgatgggaaaatg
ctggcatcggcttcggaggaccatttcattgatatagctgaagtcgagacaggagacaag
ctatgggaggtgcagtgtgagtccccgactttcactgtggcttggcaccccaagaggcct
ctgctggcttttgcctgtgatgacaaagatggcaaatacgacagcagtcgggaggctgga
actgtgaagctgtttggacttcccaatgactcctga

DBGET integrated database retrieval system