KEGG   Mus musculus (mouse): 73667Help
Entry
73667             CDS       T01002                                 

Gene name
2410004P03Rik
Definition
(RefSeq) RIKEN cDNA 2410004P03 gene
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: LLC1
Motif
Other DBs
NCBI-GeneID: 73667
NCBI-ProteinID: NP_001188261
MGI: 1920917
Ensembl: ENSMUSG00000071398
Vega: OTTMUSG00000046346
UniProt: D3Z430
Position
12; 12 A1.1
AA seq 149 aa AA seqDB search
MGSQHRGLPRTTSAGYKPPPTRQLASISAALGDGPAASRALAGGCQGTPALGVQQDQLWR
ELVEAEARGQRRWAENWGFLKDYDPLGNKKEPQELPASVPFFSDTFPCSTNREVGSRVDT
PLGKALGHMDFFFVEGTRKRKPDDELQPV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccaacatcgtgggctaccaagaaccacatccgctgggtacaaaccgccccct
accaggcagcttgcctcaatttctgcggccctgggggatggccctgctgcaagcagggct
ctcgccggtggttgccaggggaccccagccctgggtgtgcaacaggaccagctgtggagg
gagcttgtggaagccgaagcacgaggccagaggcgttgggctgagaactggggtttcctg
aaagactatgaccctctgggaaataagaaggagcctcaggagctgcctgccagtgtgccc
ttcttctcagataccttcccctgctctaccaaccgggaggtgggcagcagggtggacaca
cccctggggaaagccctcggccacatggacttcttctttgtggaaggcactcggaagagg
aagccggatgatgagctgcagccagtgtag

DBGET integrated database retrieval system