KEGG   Mus musculus (mouse): 73677
Entry
73677             CDS       T01002                                 

Gene name
Psma8, 2410072D24Rik
Definition
(RefSeq) proteasome subunit alpha 8
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    73677 (Psma8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    73677 (Psma8)
   05012 Parkinson disease
    73677 (Psma8)
   05016 Huntington disease
    73677 (Psma8)
   05017 Spinocerebellar ataxia
    73677 (Psma8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    73677 (Psma8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73677 (Psma8)
   03051 Proteasome [BR:mmu03051]
    73677 (Psma8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     73677 (Psma8)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   73677 (Psma8)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    73677 (Psma8)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    73677 (Psma8)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 73677
NCBI-ProteinID: NP_001157081
MGI: 1920927
Ensembl: ENSMUSG00000036743
UniProt: Q9CWH6
Position
18; 18 A1
AA seq 250 aa
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKY
TQSNGRRPFGISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTE
DAISNDKEAIKLAIKALLEVVQSGGKNIELAIIRRDQPLKMFSAKEIELEVSEIEREKDE
AEKTKSKKST
NT seq 753 nt   +upstreamnt  +downstreamnt
atggcttctcggtatgacagggcaatcaccgtcttctccccagatggacaccttttccaa
gtggagtatgcccaggaagcagtgaagaaaggctccaccgcggttggaattcgaggaact
aatatagttgtgcttggggtagaaaaaaagtcagtggccaagcttcaagatgaaaggact
gtgaggaaaatctgcgctctcgatgaccatgtctgcatggcttttgcaggtctgacagcg
gatgctagagtggtgatcagcagagcgcgggtggagtgccagagccacaagctcacagtg
gaggatcccgtcactgtagagtatataactcgcttcatagcgacgctaaagcagaaatat
acccagagcaatggacgaaggccttttggtatttcagccttaattgtaggctttgatgat
gatggcatcccaagattgtatcagacagatccctccgggacttaccacgcttggaaagca
aatgcaataggccgaagtgctaaaactgtccgggaatttctggaaaaaaattacacagaa
gatgcaatttcaaatgacaaggaagctatcaaattagcaataaaagctttgctcgaagtt
gtccagtctggcggaaagaacattgaactggctataataagaagagatcaacctttgaag
atgtttagtgccaaagaaattgaactggaggtgagtgaaatagaaagggaaaaggacgaa
gcagagaagacaaagtcaaagaagtcaacctaa

DBGET integrated database retrieval system