KEGG   Mus musculus (house mouse): 73690
Entry
73690             CDS       T01002                                 
Symbol
Glipr1, 2410114O14Rik, RTVP-1, RTVP1, mRTVP-1
Name
(RefSeq) GLI pathogenesis-related 1 (glioma)
  KO
K24834  glioma pathogenesis-related protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    73690 (Glipr1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Other domain-containing proteins
  CAP domain-containing proteins
   73690 (Glipr1)
SSDB
Motif
Pfam: CAP
Other DBs
NCBI-GeneID: 73690
NCBI-ProteinID: NP_082884
MGI: 1920940
Ensembl: ENSMUSG00000056888
UniProt: Q9CWG1 Q4QQK5
Position
10:complement(111821353..111838539)
AA seq 255 aa
MQVILAVIVWMASSVSSSSFTASTLPDITNEDFIKECVQVHNQLRSKVSPPARNMLYMSW
DPKLAQIAKAWTKSCEFKHNPQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIK
HYDFSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGANFICDYGPAGNYPTWPYKQGAT
CSDCPKDDKCLNSLCINPRRDQVSRYYSVDYPDWPIYLRNRYTSLFLIAKSVLLLLSVII
TIWVKHKYPNLVLLD
NT seq 768 nt   +upstreamnt  +downstreamnt
atgcaggtcatccttgctgtgatagtctggatggcttcgtctgtgtctagttcttcattt
acagcaagcactttgccagatataacaaacgaggacttcattaaagaatgtgttcaagtt
cacaaccagcttcggtcaaaagtgagtccaccagcccggaatatgctgtacatgtcttgg
gacccaaaactagcccaaattgcaaaagcatggacaaaatcttgtgaatttaaacacaac
ccacagctgcattcacggatacacccaaatttcaccgccctgggagagaatatctggctt
ggctctctatccatcttttcagtatcctcagccatctctgcctggtatgaagaaattaag
cactatgacttcagcactaggaaatgtagacatgtctgtggccattatactcaggttgtt
tgggcagacagttacaaacttggctgtgcagtgcaactttgccctaatggagcaaatttt
atatgcgactatggaccagcaggaaattacccaacgtggccatataagcaaggagccacg
tgcagtgattgcccaaaagatgacaagtgtctcaacagtctctgcattaacccacgacga
gaccaggtctcacgttactactctgtcgattatccagactggcctatatacctgcgtaac
agatacacatctctctttctcattgctaagtcggttctcctattactgtctgttataatt
accatctgggtaaagcacaaatatcctaacttggttcttttggactaa

DBGET integrated database retrieval system