KEGG   Mus musculus (mouse): 73692Help
Entry
73692             CDS       T01002                                 

Gene name
Cplane1, 2410089E03Rik, 4732468D17Rik, Hug, Jbts17, b2b012Clo
Definition
(RefSeq) ciliogenesis and planar polarity effector 1
  KO
K22859  protein JBTS17
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    73692 (Cplane1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   CPLANE complex
    73692 (Cplane1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Joubert
Motif
Other DBs
NCBI-GeneID: 73692
NCBI-ProteinID: NP_001156378
MGI: 1920942
Ensembl: ENSMUSG00000039801
Vega: OTTMUSG00000022443
UniProt: Q8CE72
Position
15; 15 A1
AA seq 3214 aa AA seqDB search
MEMRLEVLTSTSIKQKKPWPRVSWLGQENEAVFLLDEKFINEINLLSGRTKKKIPSLQPL
LKDVVFLATSTNDVWLSGVLTTGELFLWNKDQDCLKKIHVTEKPKEAIKAAVASSSRLYL
YVAENGKRILLITSSGCILLWEYLELKNILSSKSLSLVGQWSQIVPEEAVSLPSTKDKEA
VVAAVFVKNELLGDCCLCSFTFYSGECLKLTFLDIQWYENIFTSVRSLLFRVHWAQQECP
LCSLIPRCASVKSRGALISAFSRDGLALAVTLNQKDPTATQVLFINTLNFVTLCGGLKGC
SNKNPVVPATLTRSYWVGDISWTHDSLFLTCVLKRGSLVLLTCLGELLTLVTFGCSIEFG
PAEFIPLHPLITYRPQQLPFQDSNNCVDSSASESDPLRQRFSIKAHSRLPYLIISDGYMV
TTLRFLDNQSPTMLMRSLLLDSTQRLEKAYQSMMLSEPKDKGLNFRSLDSLRSSLLKHQG
KESSVHCTVPRFLQAEETMKLNETTDFQDFEGEETNEVEQFVNNSFSFCNQKKDLPFDIV
KEGRLEFASMFDTVHAKDASKETDRNTAELHRIQKTLLAAWTIGISKNVTEKKLMLNYTI
LCITHFFYILQFIKCPVPKFDLFLNKSLKRNAWVLCVFQLFHQCLSVHYWDMRYRQNMGH
LIRLTANTVKLLLTQRQEHGSFSERLLACLSLLRTVTVHLNGTCSLQPEAVPAAADESRP
AELDSLMVPIFQASKENWPWDSSLKIYPQVTNLVQKPGHRLIALWRLLYKKTLWYQAQLS
QRTPDGDRRLTENIRHEVSVVKTLLCHVQTNLQMAGDSLNQALELTPISGEECFLLASYE
KSVCLWKKALQETQEKGGRRTCFLQLRYYLSLLYCHLYCYNLNDAQGLCDHLVRELLSRS
QLPVRESQDCSDCEIAVTGNVHPEAALRVVQCMARFMAAYFTNEPLFILPPHSVSVLPPL
HVKTEHSLRLIPLQHSKVASVIRDQNLSNVWTVEYTLELLFIGGLIPEAVWMAHKLGDWK
TSVSIGVAYQVFCKHDCNFARSKKKGMDLPLNMIPAQIFQEKLQCFLGQPVSLTKKNEKG
SKYKQFTDPIEEEDASLLFGSVQEVLKASVMADADIVSETLQLLMDSAKDFSKKLWGLVP
VDLYLPAPPLYCPQPAVLSEEHGDNLLLKAEKDNRQKLSGILQRVLLLFRASRCSFPVAQ
WYILQLRWARKVMQKIRVKGSLPSLGSFPESLLNYCKGGIAFFRPGATGDHTLDEVSIKA
LGCFRELCALCWMLHVRDKLSYTCRQYQKARENTKIEKDLEVGFDSCVVEHCFHALEWAC
RMLPFSRFFNMEELIQDIILSLIGELPPIRKVAEIFVKAFPNPEAIRVPLREKYHSLQQK
LKHGVVKGPQTEELMSTVMRHVRKVRVKALKRVQRNIGAFEMDIWEPDEEDKPAATPAAD
RFSLGPSVSSTLTLDLGSSLLHSDADTFSETLSLEEKTWIHLYQRHTPSHMELALVGKKP
SDKKKVSNQKENSQRKEDDETPGKEALPVIGVWEFERDDDEYISFLELFLSYILERDLCS
SDPGIPFLTSFSGRLREHELNSLLFDVHTTLKRRQSKTISENVYRAGSCFAVTPESQEPE
NLSSLNSVGARHFESQALSASALGNQSGSTLENPLQSGSTSENPLQSDVMNWERRAGLFG
LKQKPMYRVPDDKREKPTVQRSSNHSFWVPESIKPGRHRFRALEGSAGPPREDLPLALQS
MFGDAGRLVEWMIRWSDRRLLCDPGVTPSSCKYSPVIRVKTSTAAILTSLWLLEQPYSAA
YTAKNGIIKVLERHHTEPQVAAERESDVDADCPAAVAAQEGTECWNRMPAEAENHDVKDT
GDEIAPVTPGSERELVHADGRHSEAGSSTQDEMDVHISDSEEGPVESLRGPSAVICRPES
QLSSEHSEEEAQCSRKEPRDASVDTNLTEQKGAQISDLKEKSPTVLPLMSNGAQDTSQTP
QKTQGNEHRAQLPDASESVRQMLQDEMFKLVQLQQINFLSLMQIVGPSVASLPDMHGLLQ
QAQSVRFGESQVSNSTKSDCIEVNSRQRVSARAQSMGECTREPGKNSPADHKRISRPDQD
SSGDTQDIPHGSVPLCQLDGQPEVRGQTGAPRSFAPASFPPAPAADSGLQLLFTPAAIQK
TPQLIPPARAGAPGRGFPLLHFQPKRDFKPLSLPVGRIPQVSFRPQAQPKEAWSLSDSCQ
PPVSQRTVHTTLPSPSDSSHCNAEAMRKAEAVLTGIPKHVNMGQYAGQGYLTPQQDSSVF
IKPENVFDVKPSPPETALQNSFGLPLLHLQFKPPYVFSAPPRAFSRFPSVPGTEGRNQPQ
LSLLHPCLPPENTYKKPQLIPLENLLAFKRSQQKLAHSVSGQGDAAPHFVGVSMDAAGIT
QGKQRQSRRAKRELQEGRAQKPRRKPNVSFRPEDSLISNDSEVIIEPKEQLGHHDSQHLD
KFDIPFEMLEDDINTSAGLHFMASVRKKAVGSHDASTNTDPDKEGPSQKADSESSKNPQA
TAASSGHEPLKVPQLLIPDIYLNVRLPSGIAEKPLSPSPPHMAGHKYIDVVDIEADDLLG
LPACEEPSDEVTKQQSHPPHAPSSAELHCMAASIVDAAPPHTFQSQESASSTRGLISEPA
KVTQSCQSGESWRKSVIEAKEPEIPSVAPPSDRQQDRDILEQNFQFKEQSTKLDSVGQSL
LWTLLQNASPACPTPSPAVCPRPSSPACPPPSPAVCPPPSPAACPTPSPAAQKFEHLTAK
LQEMDEQLVAVQTMAENIEQDFPASQVLNLHWEKAGLGNHVGLSSGPDIEKLLASKAISI
SEEVSLQTQEDVEEQKDAEETSETEFSEAENHSSQKTYACPSVGSAACSSVGWNIPSPGL
NDSNELLESGSEDQLQVTGLTDIADIIGDLITKSGVSSHELGLTECQARSISRIQRPPDR
GPRRTAEERREIKAWMRRKQKERMSEYLGQLAERRGRERNPFCPTSSPFYMTSRQIRQRQ
KMKREKDRLQLSKHYSQRLSQAYSLMNELLSDSAHITAPAENPLPPGPYRRQRGSSPKRE
NAHGQSLPVNRPGGDRHISRSSHLCKGQPRGSSQLRGSQPPCQSQKPLRSRGAAGVGPPV
QQACREDEREEMVVSPWTLPSEIHRILHGRPESLLQDMSPADEEEPEPPLLAGGMDSVSE
STGSILSKLDWKAVEDMVASVEDKNLSVHWALDQ
NT seq 9645 nt NT seq  +upstreamnt  +downstreamnt
atggagatgagattagaagttttgacatcaacaagtatcaagcagaaaaaaccctggccc
agagtatcctggttgggtcaagaaaatgaagctgtttttcttttggatgagaaattcata
aatgagattaatttgctgtcaggaagaacaaagaagaagatccctagtttgcagcctttg
ttgaaggatgttgttttcctggcgacatccactaatgatgtgtggctgtctggggtcctc
actacaggagaactgttcctgtggaacaaagatcaggattgtttaaaaaagatacacgtg
actgaaaagcctaaagaagctattaaagcggcagtagcaagctcttcaagactatactta
tacgtagctgaaaatgggaaaagaattctgcttattacatcttctggctgcatacttctg
tgggaatatttggaactgaagaatatcttgtcttctaaaagcctttctttggtgggtcag
tggtcccagattgtgcccgaagaagcagtttcgttgccttccacgaaagataaagaagct
gtcgtggctgctgtttttgtaaaaaacgagttacttggcgactgctgcctgtgttcattt
actttttattctggagaatgcttgaagttaacatttctggacattcagtggtatgagaat
atatttacatctgtaaggtccttgctgttccgtgttcactgggcacaacaggaatgccct
ctgtgcagtctgattcccaggtgtgcttcagtaaagtcaaggggagctctgatctctgcc
ttctcaagagatggccttgccctagcagtgactcttaatcagaaagacccaacggcaact
caggtgttatttataaacacactgaattttgttactctctgtggtggccttaaaggatgt
agtaataagaatcccgtggtcccagctacacttaccaggtcatactgggtgggggacatc
agctggacgcatgacagtctttttctgacttgtgtattaaaacgtggctccctggtttta
ttgacctgccttggtgaattgctaacgttagttacatttggttgctctatagaatttggg
ccagctgaatttattcctcttcatccactaataacgtatagaccacagcagcttccattt
caagattcaaataattgtgtagattcatcagcctctgagagtgaccctctgagacagagg
ttttctataaaagcacactcacgtctaccataccttattatctctgatggatacatggtc
acaacccttcggtttcttgataaccagtctccaacaatgctcatgaggtccttgcttctt
gattcaacccagaggcttgagaaagcataccagagtatgatgctgtctgagcccaaggac
aaagggctgaattttcgatctctggattccttgaggtctagcctgttgaagcatcaagga
aaggaaagttcagtacattgcactgtccccagatttttgcaggcagaagaaacaatgaag
ttaaatgaaaccacagattttcaggattttgaaggagaagaaactaatgaagttgaacaa
tttgtaaacaattcattttctttttgtaaccaaaaaaaagatctaccgttcgatattgtc
aaggaaggaagattggagtttgcatctatgtttgatacagttcatgcaaaggatgcttcc
aaggagacagacagaaacactgcagaactacaccgtatccagaaaacactacttgcagct
tggactataggaatttcaaaaaatgtaacagaaaaaaagttaatgttaaattacacaatt
ctttgcatcactcattttttctatattcttcagtttataaaatgtcctgtgcctaagttt
gacctgtttttaaataagagtctgaagcgtaacgcatgggtactttgtgtctttcaactc
tttcatcagtgtttatcagtccactattgggatatgagatacagacaaaacatgggccac
ttgataaggctcaccgcaaatactgtaaagctcttactgactcagcgacaagaacatggg
tcattctcagagaggcttttggcttgcctctctttactgcgaactgtgactgtccattta
aatggcacatgcagtcttcagcctgaggctgtcccggcagccgctgatgaaagtagaccg
gcagagctagactcattaatggtacctatttttcaagcttctaaggaaaattggccttgg
gactcatctttaaagatttatcctcaagtgacaaatcttgttcagaagccaggtcacaga
ttgattgctctttggagactactgtacaaaaaaactttatggtatcaagcacagttaagc
caaagaactcctgatggtgacagacgattaactgaaaatataagacatgaagtatctgtt
gtcaagactctgttatgtcatgtccagactaacctgcagatggctggggatagcttgaat
caagccttagaacttacacctatcagtggtgaagagtgttttctgctagcatcatatgaa
aagtcagtttgcctgtggaagaaggctctacaagaaacccaagagaaaggaggaagaagg
acatgttttcttcagttacgctactatctctctctcctgtactgccacctctactgctat
aatttaaatgatgctcaagggttatgtgatcatctagtacgggaactactcagccggtcc
cagttacctgtaagagaaagtcaagattgttcagattgtgagatcgcagtgactggaaat
gtccacccagaggcagcactcagagttgtccagtgcatggcccgcttcatggctgcctat
ttcaccaatgagccactcttcatcctgccgcctcacagtgtgagtgttctccctccgctt
catgtgaaaacagagcattccctgcgacttattcctctacaacactctaaggtggccagt
gttattagagatcagaatctctcaaatgtgtggacagttgaatataccctcgaattatta
tttattggtggcctgattccagaggctgtgtggatggcacataaacttggagactggaag
acatctgtttccattggtgtggcctaccaagtgttctgtaaacatgattgcaattttgcg
cggtccaagaaaaagggtatggacttaccattaaatatgataccagcacagattttccag
gaaaagctgcagtgctttttaggtcagccagtctctttgacaaaaaaaaatgaaaagggc
tcaaaatataagcaatttacagatcccattgaagaagaagatgctagtctgctgtttggg
tctgtgcaagaagtgctgaaagcatcagttatggctgatgcagacattgtttcagaaaca
ctacaactgttgatggactccgctaaggacttcagcaagaagctgtggggcttagtgccc
gtcgacttgtatcttccagcgcctccgctgtattgcccccagccagctgttcttagtgaa
gaacatggtgacaatcttcttttaaaagctgaaaaagataatcgccaaaagctgtctgga
atcctgcagcgagttctcctgcttttccgggcatctcggtgttcttttcctgtagcgcag
tggtacatcttacagctgagatgggcaaggaaggtgatgcagaagattcgagtgaaaggg
tctcttccttctcttggttctttcccggaatccttacttaattactgtaaaggagggata
gcattctttagacctggagcgactggagaccacacgcttgatgaagtttccatcaaagcc
ctaggttgcttcagagaactttgtgctttgtgctggatgttgcatgtccgggataaattg
tcatacacttgcaggcagtatcagaaagcaagagaaaatacaaagatagaaaaggacctc
gaggtagggtttgattcttgtgtggttgagcactgttttcatgcactggaatgggcctgt
aggatgctaccattctctcggttttttaatatggaagaacttattcaagatataattttg
agccttattggagaactgccaccaatcagaaaggtagcagaaatttttgtgaaagcattt
cctaatcctgaggccataagggttcctttaagagaaaaataccactctcttcaacagaaa
ctcaaacatggtgttgtgaaaggtcctcagactgaggaactgatgtctacagtcatgcgg
cacgtccggaaagtgagggtgaaagccctgaagcgcgtgcagaggaacataggtgctttt
gagatggatatctgggagcctgatgaagaagacaagcccgctgccactcctgctgcggac
aggttctccctggggcccagcgtgagcagtacactcacgttagacctgggcagttcccta
ctacacagcgatgccgacaccttctccgaaaccttgtctttggaagaaaaaacttggata
cacttgtatcaaaggcataccccaagtcatatggaattagcattggttggtaaaaagccc
agtgataaaaagaaagtaagtaatcagaaagaaaactcccaaaggaaggaagatgatgag
acaccagggaaggaagcactgcctgtcattggtgtttgggaatttgaacgtgatgatgat
gaatatattagcttccttgagctcttcctgagttatattcttgaaagagacctttgttcc
agtgaccctggcattccatttttgacaagcttttctgggcgccttagagaacatgaactt
aattctttactttttgatgtacacacaacattaaaacgacgccagagcaagaccatcagt
gagaatgtgtacagagctggttcctgctttgctgtcactcctgagtcacaggaacctgaa
aacctgtcctctctaaacagtgtgggtgcccgacatttcgaaagccaggccctttcagct
tcagcactaggtaaccagtcagggagcaccttggagaaccctctgcagtcagggagcacg
tcggagaaccctctgcagtctgatgtcatgaactgggaaagaagggcaggattgtttggc
ttaaaacaaaagccaatgtatagagttccagatgacaagcgagagaagcccacagtgcag
agatcatcaaaccattccttttgggtacccgagtccattaaacccggaagacacagattc
cgagctcttgagggcagtgctggcccccctcgggaagaccttcctctggcactgcagagc
atgttcggcgatgcggggagactggtagagtggatgatccgctggtcagatcggagactt
ctctgtgatcctggggtcactccgtcatcctgtaaatacagtccagtaattcgtgtgaag
acctctacagctgccattcttacctccttatggcttctggagcaaccctactctgctgca
tatacggcaaaaaatggcattattaaggttctagagcgccatcacactgagcctcaggtg
gcagctgagagggagagcgacgttgatgctgactgtccagctgcagtagcagctcaggaa
gggactgagtgctggaatagaatgccagctgaagcagaaaaccatgacgtgaaagacacg
ggtgatgagattgctcctgttactccgggctctgagagagagcttgtgcatgctgacggg
cgtcattcagaagcagggtcatctacacaagatgagatggacgtgcacatctcagactct
gaagaaggacccgttgagagtctgagaggtcccagtgctgtcatctgcaggccagagtca
cagctctcatcagagcattccgaagaagaggctcagtgttccaggaaagaaccacgagac
gccagcgtggatacaaacttgacagaacagaaaggtgcacagatttcggaccttaaagaa
aaatcacccacagttctacccctcatgtcaaatggagcccaggatacttcacaaacacct
cagaagacgcagggaaatgaacacagggctcagttaccagatgcttccgagtctgttagg
cagatgctccaagatgagatgtttaaattagttcagctgcagcagatcaattttctgagc
ctgatgcaaatagtaggaccgtcggttgctagtctcccagacatgcatggacttcttcag
caggctcagtctgtgcgttttggggaaagccaagtatcaaactccacaaagagtgattgt
attgaagtcaacagcagacagagagttagtgccagagcacaatccatgggagagtgcacc
agggagcctggcaagaacagcccagcagaccacaaaagaattagccgtcctgatcaagat
agtagtggagatacacaggatattccgcatgggagtgttcctttgtgtcaattagatggc
cagcctgaggtgagaggacagactggagcacctcggagcttcgcacctgcttcctttcct
cctgcccctgctgcagacagcggcctccagcttttgttcacacccgctgctatccagaag
acgcctcagctgatcccccctgcccgagcaggcgctcctggccgtggctttcctctgctt
cattttcagcccaagcgtgacttcaagcccctttccttacctgtaggaagaattccacaa
gtttctttcaggccccaggcccaaccaaaagaggcctggagcctgtcggactcttgccaa
cctcctgtgtctcagagaacagtgcataccacgttaccatctccttcagattcgagccac
tgtaatgcggaagccatgagaaaagcagaggctgtcctcaccggcatcccgaagcatgtg
aacatgggtcagtacgcagggcaagggtacttgacccctcagcaggattcttcagtattt
ataaagccagaaaatgtgtttgatgttaaaccaagcccccctgagacagctcttcagaat
tcttttggacttcctttattacacttgcagtttaagcctccttatgtattctcagcacca
ccaagagcattcagtcgatttccctcagtacctggcacagaaggaagaaatcaaccgcaa
ctgtcattacttcatccgtgcttgcccccagagaatacgtataagaagccccagcttatc
ccacttgaaaatctcctggcatttaaaagaagccaacaaaaactggcacacagtgtgtct
ggacaaggtgacgctgctcctcactttgtaggagtcagcatggacgcagctgggataaca
caagggaagcagaggcaaagcaggcgtgccaagagggagctgcaagaaggaagagctcag
aagccgagaagaaaaccaaatgttagcttccgcccggaggactccctcattagcaatgac
tcagaagtcatcatagagcccaaggaacaactaggacatcatgattctcagcatttggat
aaatttgacattccttttgaaatgttagaagatgatattaatacttcagcaggactgcat
ttcatggcctctgtacgaaagaaagcagtgggaagtcatgatgcgagtacaaacacagac
ccagataaggaaggtccttcccaaaaagctgattcagaaagtagtaaaaacccacaagcc
acggctgcaagctcaggccatgaacctttgaaagttccacagcttttgatcccagacata
tatctaaatgtcagacttcccagtggaatagcagagaaacctttgtctccttccccacct
cacatggctggacacaagtatatagatgtggttgacattgaagctgacgatctgttggga
ttacctgcctgtgaagagccttcagatgaagttaccaagcagcaaagtcaccctccacac
gctccgtcttcggcagagttacattgtatggcagcttccattgtcgatgccgctcctcct
catacttttcaaagtcaagaatctgcaagctctactcggggtttaatttctgaacctgca
aaagtgacccaatcctgtcagagtggggaaagctggagaaaaagtgtcatcgaagcaaag
gagcctgagattccctcagtggcgccgccgtctgacagacagcaggacagagatatacta
gaacaaaacttccagttcaaggaacagagtacaaaattggactctgtgggacagtccctg
ctttggaccctgctacagaatgcctctcctgcgtgtcccacaccaagccctgctgtgtgt
ccccgtccaagctctcctgcgtgtccccctccaagccccgctgtgtgtccccctccaagc
cccgccgcgtgtcccactcccagccctgctgctcagaagtttgaacatcttactgccaag
ctccaggagatggatgagcagctggtagcagtgcagaccatggcagaaaatatagagcaa
gacttccctgcatctcaagtgctgaatctacactgggaaaaggctggactggggaatcat
gttggattgtcttccggccctgacattgaaaagctactagcttcaaaggccatcagcatt
tctgaagaagtgtctttgcagactcaagaggacgtggaagagcaaaaggatgcagaggaa
acttcagagactgaattttcagaagcagaaaatcattctagccagaaaacctatgcatgc
ccttctgtggggtctgctgcttgctcttctgtgggctggaacatcccttctcctggtttg
aatgacagcaatgaattacttgaaagtggttcagaagatcagctccaggtgactggcttg
acggatattgctgacatcattggtgaccttataactaagagtggagtgtccagccacgag
cttggcttaacagaatgtcaagctagaagtatatccaggattcagcgtcctcctgaccga
ggcccccgtagaactgccgaggagaggagagagattaaagcctggatgcgaaggaagcag
aaggagcgaatgtcagagtacctaggtcagctggcagaaaggcgggggcgggagcgcaac
cccttctgccccacaagcagcccgttttatatgacttcaaggcagatcaggcaaaggcaa
aagatgaagcgtgagaaagataggttgcagctgtctaagcactatagtcagcgactctct
caggcatacagcctgatgaatgaactgctgtcggactcggcacacataactgcacctgca
gagaatcccttacctcccggaccttacagacggcagcggggctcctctccaaagagagag
aatgcacatggacagagtttacctgtaaatagacctggaggagacagacatatctccaga
tcaagccatctctgtaaggggcagccccgaggatcgtctcagttacgaggctcccagcct
ccctgtcagagccagaagcctctgagaagccgtggggctgctggcgtgggtcctccagtg
cagcaggcgtgcagagaggatgagagggaagagatggtggtgagtccctggacgctgccc
tcggaaatccacaggattcttcacggcaggcccgagtccctcctacaggacatgtcgcca
gctgacgaggaagagcccgagccccctcttttggcgggtggcatggacagcgtgtctgag
agcacaggcagcatcctgagcaaacttgattggaaagctgttgaagacatggtggccagc
gtggaggataagaacctgtctgtgcactgggccttggaccagtag

DBGET integrated database retrieval system