KEGG   Mus musculus (mouse): 73723Help
Entry
73723             CDS       T01002                                 

Gene name
Sh3bgrl3, 1110004L05Rik, AU022188
Definition
(RefSeq) SH3 domain binding glutamic acid-rich protein-like 3
  KO
K23740   
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: SH3BGR Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 73723
NCBI-ProteinID: NP_542126
MGI: 1920973
Ensembl: ENSMUSG00000028843
Vega: OTTMUSG00000010335
UniProt: Q91VW3
Structure
PDB: 

Position
4; 4 D3
AA seq 93 aa AA seqDB search
MSGLRVYSTSVTGSREIKSQQSEVTRILDGKRIQYQLVDISQDNALRDEMRTLAGNPKAT
PPQIVNGNHYCGDYELFVEAVEQDTLQEFLKLA
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcctgcgcgtctacagcacgtcggtcaccggctcccgagaaatcaagtcccag
cagagtgaggtgacccgcatcctagatgggaagaggatccaataccagctagtggacatc
tcccaggacaacgcccttcgagatgagatgcgaaccttggctggcaaccccaaagctacc
ccacctcagattgtcaacgggaaccactactgtggggactatgaactcttcgtggaggcc
gtggagcaggacacactgcaggagttcctgaagctggcctga

DBGET integrated database retrieval system