KEGG   Mus musculus (house mouse): 73732
Entry
73732             CDS       T01002                                 
Symbol
Muc16, 1110008I14Rik, Ca125, Gm1480, Gm21044
Name
(RefSeq) mucin 16
  KO
K16145  mucin-16
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73732 (Muc16)
Membrane trafficking [BR:mmu04131]
 Others
  Mucins
   Membrane bound mucins
    73732 (Muc16)
SSDB
Motif
Pfam: SEA PilN TMIE Smim3
Other DBs
NCBI-GeneID: 73732
NCBI-ProteinID: NP_001365177
MGI: 1920982
Ensembl: ENSMUSG00000109564
Position
9:complement(18406741..18586117)
AA seq 8805 aa
MGEEDVACSAHRHRHRYLLTLTTSLLLAYGPASAFQEPHSSSGPMTSVLRPIPKTNTRKL
DTSTTVTASTLHWRSNIPSKLAAMKGTRNSKKAVNIINSTSSTPDVTFGSVLLKTTLSTK
IPETTGKSTGYPSMTTSNFTRTETHNGTALNSTLLSDTSTTVTVAETNITEIISTTEHTP
NFTEVPFTNSVLVSRTESTNNSISYPITNQVIKAEEISTGMPTGPPNSIISKEITTSQIE
HFVVTPNIIASQGIPATTSGAGMHSSVSHNYSLLETSTLLKSDKVPSRTNSSPLEGISSE
SSWKTTVRTSSSSPVKLSSQRHLPITHHTTKQSWTTAQIQSSTLEEVDLITEYSLNHTEV
PMNLSLLEPSTKDMSTGNISFTTLHESISEDTSFGITIGTPSSSITSKLQQLSNSHNGHS
VVTSSMVTSKSPSTSASINVTNSSRVQTFPHPEAMDPPKNITSGPQTHNLWEESVFEDST
MPHESHSPSAISSIRDTHSTSFTGSVAYVITVSKDTIPTDLSTRSEPVISSIQSLNGSPQ
KSFNIAQVSKISQMTSVSSVTKGNKKNGSSTPKLKHTIIPTPISSEHEYFTTILARSEDT
TLSSPQSISFTTAEIGKPTDSSLMKAWKSSSKYEDIHSTKEHRISQTNVPTTLSLVTSVA
KDISAGSTFLSKLHHSISEDTSTGISTKYSRSTTTTESEQTATSHREHTVVTSNMVTSKD
LSTTSSNTETQHSGTQTFTLSESMVNSTNINPATTLRTNSVWEGSMPTSSTRTPDEAPSH
SPVSANADRYSTPSSVSASIVTISKEPNPTRLYVIPKSVTPSIPSSNSTQFSKIPQTTSV
SLLGSVEGMKKSTFKHAITPISVSLEKESFTTILPTMEQARLSPSQSVSSERTDTERGIS
FPLRTAWTDFSTSEQINTSTEYSTSHTELSTSPSPLESRTGLTSADSISISDLQSTLQDT
SSGTSISIPASTVSAESEEMKSRPMGLYPVISDILTYPDSSSTVSVKGTHSSGTHTFPHS
ESRAPFNNLASASWTPTPEKGTISTDSTKTQESLSLTADTYMPHTHSSHSPDSVVSFFTS
SKDSIPTDSYTSLGPVTVYVPSWSSTSQSSSNTVHASQMSQMNTFSSVTSGSNMGDSHSV
PEFKYTTTSVSVPSELSTEKKTFPTTLPTTEVATLIPTKSTSYENTSSGTKTVTLLTTLT
QANSPEKVHSSTDFIRHPSEVPNSSSTPVSSTRSMSPDNAILPTLWHFTSEHTGFTPEDM
TSGTVTKCYDSNTITESQEVSTSQIRDSNVTSNIALSLKTSTMSSESDNFMSFSPAPTIT
ETSTFVSQSYEVPSIATFSTLKGSPLGNSPGYLNESSLTSSVTSTGENNTPSPSPVVSVF
TSSKEKITTRLDKPLHNLSTSFSNWTTNTHTSQETSQATEFSQTSSASSVNSEIITEVSS
SIPQPKFSVSESIRAGRTLTRSPLYSSESEDITPGSISRLITYPSTEHIGLTSIFGTANS
GSLLSDSLSRDIAATVPMKEFSSPEPQTSPHLSWISESHSFEEQSQTSSLSKGKHTSTDP
TSTMIEKTTLSPVTSTSQGQNVSSLDFLAALVTSIHETNSNGQDTSATSGSNSIQSLDTI
GLSTPGSSYNMKTFQTSHISPKNPATRVETDSPAMHPQGTVLVNSVPSRITEIMISQSNW
DTISPSMPLSSPVHAETQKAFPITSIEQETTRSEDTDLMKKHSSGLLTVSTSTYPGISRT
EANSTDTTSTSNSVSFAKTTDTSVGNASSSSTLFFPRTDISQVVNVEESSNITTLLNTSD
PITYSGALSTVTQTFLHSDSISHPSSSELLSWTDSPLHEATSSVNSIETIHTSSFPVTSP
SEGQGLFFPSSEETTTEELDTNLAFFKTSFPSWSNSELAISKDTRTSQKSYNSTKTEVSP
VNITTSEPPAQYTVSPETLSADSTASSLLIIPTKISASASPLLPQRSNSTSFPKTSFPTS
ELFKTTDILDRSLETGISLPPNLRSTSLEILGLSEVVTDTEKHHSSSSFTVTNVNTITVG
HELSSSVSTLSESSRDADTSGTPPSVWVTTILTSLPNHLETTRSNTDSFSHLTSGLRDTS
ISLQTNKPSPLESTLHLPSSETDVATAVNIPTPYQSPSPKFTDIPIATATILNPSSSIVE
STGATSFPEYDFTMLSRENIHVPRTDILPSAETTLIDTTATLSPRGMTFFATTSNPTGIS
AVTSESSHSMIQSSHLFATIVKKPPSSISTPLPYPISTTTDTAASSSLQRITTPSEMEDG
MQYHTDISNGAVHGDTAGLGKGSLASTSSANHKDLTTEGTVKADTTTRALKASSIFTPNT
KMSTTISTPPTHIKTSKKTTNINTTEMIITASDASHNLLEMAPSFSTGLRENISMVARTS
PSSYSRKPEITIPQIPSLKTKTIPNVNTLTVSSAESDTISWITHALEITSAIAKTTKNAS
QVELDSKVSTATSSRGKDRSTLSTAAVSSAIPDLASIEQEDRLFGPTISISSSIPDMKNL
EGYSSKEDIGTSKPILTHSPSEPYNTISLISHAGGKTDSPMSTIAVSPDVTEIMRPLFTS
SGRRIHTRNPTQGQSVTTSWITHPGTEATSRVLTTTISPNNQEVETSKSANPSKLQTTTS
LITDSKEQPSFTMSTLAVSLGVIEGTPSPVINRGTERNSRTATLDFFLDLPETTTSWTTN
PEKEAISGILTTKYAPSVTDRMTTINLNHTPPEPQNITSLATHYVRHSLITSTKVVHPDI
EEVKPSQVTSSVTESHVMTSNMAFSPGKHETINPFVTHPRRKVTSGILTAAISPSVTNMM
TFTPVKHSPSEPQPIESLDTNAEGHPSASMSTQALSPGMREMMIPQAPNYGRETYITTST
LPVSVGQIESTASLVTHAEKEATLGVLPTTVSTISPNMMASTELMSSGPHTTASLVTHNG
EQHSSDMSTLPASSGITKIKQSLDTTTGKESQSVITTLAVSLGIPKTKSINTTSNVPDMM
ISKSWNHTSSNVHTITSLVTHAGTQSSFSKSTKAASPSITKLTASLFTDTDTENVAITAL
PTSSGQMEKRAPSVTKPEKETISDVLSITTSTSVQQMMISPTVIPSEPHTTVSFDTHVGG
QPSSTMSILPVTSDSTKIISSLGTRSGTESHSVTSTMDISQGQLETTASGDTHTEREGNS
LTLSTVISTSAPDIMTSTNENQTSSDRQTIISLLTLAGEDTSLSVPSQGGSPGIMKVTPS
LFTDVGTEGYAITSTLPVFSGQPDTRTPWDKHSETKVTTVVLPTTISTSVPEIMTSPTPI
PSEAHTTVSLITHAGGAPSLAMSTLPVSGALTENIPSKVTYRGKEGNSVTSALDVSWDQK
ESTAPWVSYQAKEGPSEVLSTNISTRAPDMVFSTNKNQTSSDTQTMTSLITQTGEQTSLS
ESTQGVSSAITKMTQSIFNDLGTESYEMTSTLPASSHQSETRTKWITHSKIEQMSGVLST
TNSSSAPKMMTSTPITSELHATVSLVTHVGAQHSSTMSALTASPGKTEIMPSEQTHTGTE
IHSVTSTLDVSAGQEELTTAWVTQSEKERTSGVLSTAISLSVPNMTSATLNNNSLDIRTI
TAFMKHPAGKSSLSMSTEGISPRITEVTPSLFTDLGTESYAMTSTMPASSGQSETRKSWN
TNSEMEATPGVLSTSITTNVSEMITSSTSFPSEPHTTVSLVTQLGGNSSSPMSALPASPG
RTEIKSSLVTYPDTESYSVTSTLDIFTGEAESTTPASTHTGREGTSETVTRNTSTSVPDM
MTSITKRHSASNTQIMESLVDSMEIHHGGKPSLSVSSQHVTPDITEVTQSLFTNLGYERN
TVIPTLPVSPGQPDTQATWVIHSEKEATSRVLPTSTSPHVSEPKASPTDIPSEPQNTVSL
LTQVGGQSSSAMYILQTSTGRTKIKPSVVTQPGTESFAMLSTPDISQGQTESATPWPTHP
PKKGTSEVLSTTISNSSPATMTSITKNQTSFDSQNITSFITHAEVQPSLSVSMQDISTGK
AKVSTSQFTDLGRENCAMTSMLPALSGQVETKAPWDTNSEMEGIFGPVSTIISSSVPEMM
TSPNVIPSEPHTKVPLSNHDVGQPTSIMSTLHVLPSIPEFKPKLDTSYGAESQSLTSTMG
IFVDQARSTNTWATHTGRKDTSGIESRLISTSAPEMMTSITKNQTSSETKTITPYVIQAG
GESTSGTVSKIISTSAPEKMNSVTKNQTSSDTQITHAGEQPSLSVSTQDISPRITEVIPS
EFTDIGPKRFAMTSTLPASPGQAETNGTITPWNSNSEMEATSGPLSTTILPGVQEMMTSP
SVFPSEQQTTVPLVSHYVGQPTSVMSTLPFSPGRTENMPSLVSSSGIQSHSVTSIKDTSV
NKAVSTTTWATHTGRENTSGTESTLISTSAPETITSITKHQTSADTQTIMSFITHPAGQP
SLSVSPYGASPGITVVTPSQFSDLGTESYAMASTLPASPGQAESKTPWDTHSEMEATSGP
VPTTISPGVLETMTSPTVIPSEPPTKVPLVTHVVGPSTSSMSTLHVSPGIPEITPSVVTS
YGPESHSATSTQVISIDQAGSTTTWSAHTGRGNTSGTESTLISSSGSEMMTSIKKIQTSS
ETQTITSFITHAGGESTSGTVSTVISTSAPEMVNSLTKNQTSSDTQITHAGEQPSLSVST
QDVSPRITEVTPSEFTDLSSNNYAMASTLPSSPGLEETKTPWNSNSEMEATSGHLSTTIS
HGVPQMMTATTVIPSQPHSTLPIVTHIPGQQTSVMSIFPFSPGRTERMPSLFPSPSRENH
LVSSTQDISIDQAVSTTPWPNHTGNKITSGTKSTLISTSSAETMTSITKNQTSSATQTSF
ISHAAGESSLSGSTYGVSFGITQLSPSQFTDLGTKNYAMTSTFPASPSEIETKAPWNTNS
KMEASSGPLSTTISSGVSEMRTAPTVASSETHTKVALVTHIIGQLTSVGSTLPFSSGKIE
NMPSLVSSSGIQSHSGTSIQDTSVNQAVSTTTWATHTGRENTSGTESTLISTSAPETITS
ITKHQTSSDTQTITSFITHSAGQPSLSVSPYGASPGITVVTPSQFSDLGTESNTMTSTLP
ASPGQAESKTPWDTHSEMEATSGPVPTTISPGVLETMTSPTVIPSEPPTKVPLVTHVVGP
STSSMSTLHVSPGIPEISPSVVTSYVPESLSVASTMSIFIDQAGSTTTWSAQTGRGNTSG
TESTLLSTSAPELMTSLTRNPNSSETEAITSFITHPGEESTSGTVSTIISSRAPDVMTSV
TKNQTSSETQTITSFITHHGGQPSLSVSTQGVSPRITVVTPSEFTDLSSKSYAMTSSLPT
SPGLEETKTPWVSSSELEATSGPLSTTILPGVQEMMTSPSVFPSEQQTTVPLVSHYVGQP
TSVMSTLPFSPGRTESIPSVFPSSGTESHSVTSTQDTSIDQAVSITPWSTLTGRGHTLGT
ESPLISTSAPETITSITKNGTSSDTQTITSFITHHGGQPSLSVSTQGVSPGITEVTLSQF
TDFSTKNYAMTSTLPASPGQAESKTLWNTNSEMETNSGPLSSTISSVVQEMMTSPTVISS
EPHTNVPLVSSDVVQSSSSMSTLSVSPGTPEITPSVVTSYVSESHSLPSTLPVSSSQSKS
PAQWITHTGHEGASGNLSPTISPSVPEIMTVTTLNHTLPKSLTITSLSTQVGVQPSLNRT
TTAFSPSIPKLTSLSTNLGIESHHTTVSLSPSLSETIASLVTHSQKEASLGVLTTTIPST
ILDTMTSPSLLTSESYTTISLTTPLEGQPSSSMSTLAVSPGVTEKIPLLVTSSSTNTHSV
SSTLHASPGQLETPALMVTPPEREATSSILRTDISPSIPDLMASKTHNPSEHTTISSVTY
VGGQSSPSISTLTKFPSIKDIMTPLATTSVVETHKTAPTLSVPADQRETTALWVIHSGKE
LMSTVSSPPTLPGDSERTETWLILSAKTSTPHPTITSTFSYNDITSSVSEVETSSATTLS
SGASEEAASLSGHTGTETSTSTLTVTPSSTSPGTTGLQPSSPSKEYTLTMSSSLPVFPDH
STTSKFGIATSKNIETSPSLSTVRLSDFVSDVISPAMTLSSESSTHAPTDLETTRETTHS
ATTSSKPTGDKTTTSLHESSSALLTTRRISTLSPENVTSRPTTNPSLVPFTLNFTITNLH
HTEGMASQGSEIFNSTERILNSLLKPMFKNSSIGHLYSGCRLITLRPEKDGTATGVDAVC
TLHSDPLGLQLDREKMYWELSHNTQGVTKLGSFTLEKDSLYINGFTHIKTSASTLNTPVT
SSLFFTETSTAKPTLSTVPGSPLVPFIINFTITNLEYEEGMSHAGSWKFNATEKILQRLL
WSLFNKTSIGLLYSDCRLALLRPEKDGAATGVDAICTHHAGPIGPGLDSERVFWELCNLT
NNVTKLGPYTLDKNSLYINGYTHQIQSITSPTTSPSLLPFTLNFTITNLQHTEGMAFQGS
EIFNNTERILNSLLKPIFKNSSIGHLYYGCRLISLRPEKDGTATGVDAVCTLHSDPLGLQ
LDREKMYWELSHNTQGVTKLGSFTLEKDSLYINGFTYTKISASTLNTPVTSSLFFTGTST
AKPILSTVPLSSLVPFTINFTITNLKYEEGMNHPGSWKFNATERILQRLLWPLFNKTSIS
LRYSNCRLALLRPEKDGAATGVDAICTHHAGPIGPGLDSERVFWELCNLTNNVTQLGPYT
LDKNSLYINGYTHQIQSITSPTAGPVLEHFTINFTIINLKFEEDMSHPGSRKFNITERTL
QRLLRILFKKSSVGALYSGCKLSLLRPENDGAGTGVDAVCTHYPDPTGLGLDRKMLYGEI
SRLTYGVKRLGPYTLNDKSLYVNGYTHQIVATTTQMAMMTIASMGMINNSPSPTAGSGLV
PFTINFTVTNLKYVENMHHPGSRKFNTTERILQKLLKALFSKTSVGPLYSGCRLILLRLE
HNGTATGVDAICTYHPNISNQGLDRERVYWELKRLNITQLGPYIVDENSLYINGYTQQIL
STTSRPSVMATVSEGMPNISSTPTATSPVLVPFTINFTITNLEFKKDMGRPGSRKFNVTE
RTLQSLLRPLFIKTSVGQLYSGCRITLLRPEKNRAATGVDATCTYHLDPAGHRLESEQIY
EELSNLTQSVTQLGPYILDQNSLYVNGYTDQILATTPRALSSALLRCTLNFTITNLPHTN
DMWVPGSAKFNKVEKILKLLLKPLFQNTSVGLLYSGCRLTSLRPKKDGEATRVDMVCTYH
PNTTGTGLDREQLYLELEQLTHNITQLGPYSLDQNSLYVNGYTHQTAVTSPSKSPLEIFT
FNFTITNLLYTENMQPPGSKKFNTIEKILQGLLGSLFKNTSIGPLYTGCRLTSLSSRKDG
KATEVDTVCSYYADHMGPGLATEQLYLELSNLTHGVTKLGPYTLDQDSLYVNDYTYSASS
IFHNTSSLVPYSTNNSTGNGTVMVSITLNFTITNLHYTEEMGHPGSLKFNSTKWTLHYWL
DTLLNKTSIAPLYSGCRLASLRSDDHRAATEVDVICNFHSYSMSPGVNQDQLFWELSHGT
HGITHLGPYTLDQNSLYINGNSFGAAAPNTTTGELSEELFTVNFTINNLRYSADMSQIGS
PKFNITDTLMQHLLGPLFQRSSLGPLYTGCRVATLRSMKNGAQTQVDVLCTYRRVFNSQG
LPAKPIFYDLSWQTHGITKLGPYSLDKDSLFINGYNEPGPDVPPTTPEPATTILPSPTTS
LQPESNTVMWHKPETFTINFTISNLPYSVDMISGSAIFNSTENVLQRLLGPLFQNDSFNS
SCRLTSLRPEKNGMFTGVVTTCTYQNDPAHPGMDIQGLYSELSHLSHGVTQLGNYTLEEH
SLYVNGYPILGPDILTTTPEPSTTILPFTLTSVQPESTTARAHHLKTITINFTISNLPYS
AEMNYSSAMFNSTESVLQHLLRPLFQNNSFNASCRLTSLRPEKNQNSTNVNVICSYQHYS
AHPGLHTQELYSELSHLTHGFTQLGNYTLDKDSLYVNGYNEIGTKEPTTNPETATTMLPS
PSILVQTESTTAVGYHLKTVTVSFTISNLPYSAHMNNGSAVFNSTETVLKHLLEPLLHNG
SFNSSCRLDSLRPEKNGTATAVEAICTYYHNAANSGIDTQELYSELSHLTYGITQLGNYT
LDQESLHVSGYNEPHPEEPPTTPEPTTTMQPSPSTALHPEPTTGHHLKILTINFTISNLP
YLSNMSNGSAMFNSTESVVQYLLSHLFQNGSFNSSCTLDSLRSRKNGTATGVNVICIYHH
DPENPEMDIHGLYLEINNLTHGITQLGNYSLDNGSLYINGYNEHGVEELYTAPESPSTIV
PSSSTFVKGEPTVAMGNLKTFTLNFTISNLPYSTDMSSGSAMFNSTERILQHLIRPLVQN
ESLYSNCRLASLRPKKNGTATGVNAICSYHQNPDHPELDTQELYTKLTQLTQGVTQLGSY
MLDQNSIYVNGYTHQTAETTSSGYVPLNITIQGKYQLNFCIINWNLNNTDPTSSEYITLE
RDIEDKVTTLYTGSQLKEVFQSCLVTNMTSGSTVVTLEALFSSHLDPNLVKQVFLNKTLN
ASSHWLGATYQLKDLHVIDMKTSILLPAEIPTTSSSSQHFNLNFTITNLPYSQDIAQPST
TKYQQTKRSIENALNQLFRNSSIKSYFSDCQVLAFRSVSNNNNHTGVDSLCNFSPLARRV
DRVAIYEEFLRMTHNGTQLLNFTLDRKSVFVDGYSQNRDDDVMKNSGLPFWAIILICLAV
LLVLITCLMCCFLVTVCRRKKEGDYQVQRHRLAYYLSHLDLRKLQ
NT seq 26418 nt   +upstreamnt  +downstreamnt
atgggagaggaggacgtggcctgctcagcacatcgacacagacacaggtatctgctgact
ctgacgaccagtcttttactcgcctatgggccagcctcagcgttccaagagccacatagc
tctagtggacctatgacttcagtgctcagaccaatacccaagacaaacacaagaaagttg
gacacaagcacaacagtgactgcttcaactttacattggagaagtaacattccttcaaag
ctggctgctatgaaaggcacgagaaactcaaagaaagcagtgaacatcataaattctacc
agttctactcctgatgtaacatttgggtcagttttacttaaaaccacattgtccacaaag
atccctgaaacaacagggaagagcactggttatccttcaatgactacatctaattttacc
aggactgagacacataatggaactgcattaaatagtactcttctatcagacacatctacc
actgtaactgtggcagaaactaacataactgagattatttcaaccacagaacatactcct
aattttaccgaagtgccctttactaattctgttcttgtatccagaacagaatctacaaat
aacagcatttcctatccaatcactaaccaggtaatcaaagcagaagaaatctccactgga
atgcccactgggcccccaaactccataatcagcaaagaaattaccactagtcagatagaa
cattttgtggtaaccccaaacattattgcatctcaaggtataccagcaactacctcaggg
gcaggaatgcactccagtgtctctcataattattcattgttagagacatccactcttctc
aaaagtgacaaagtcccctccagaacaaattcatcaccactggaaggaatcagctctgaa
agttcctggaaaactacagtaagaacaagttcatcatcacctgttaagttatcatcacaa
agacatctacctattacccatcacactaccaaacaaagttggaccacagctcagatacaa
tctagcacacttgaagaagtggatttaatcacagagtatagtctcaaccatactgaagtg
cccatgaatctttctcttcttgaaccttcaacaaaagacatgtctactgggaacatatct
tttacaacactacatgaatcaatatcagaagatacttcttttggaatcaccattgggact
cctagttccagcatcacttcgaaattacaacagttgtcaaatagccacaatggacattct
gtggtgacatcaagcatggtgacttctaaaagcccatcaacctctgcctcaatcaatgtc
actaactccagtagggtccaaacatttccacatccagaagccatggatcctcccaaaaat
attacttcaggaccacagacacataatctttgggaagaatctgtgtttgaagattccaca
atgccacatgagtcacattcaccttctgctatttcttccataagagacacacacagtaca
tcatttactggttcagtggcctatgtcatcacagtttctaaggacacaatcccaacggat
ttgtccacaagatcagaacctgtgatttcctcaatccaaagcttgaatggcagtcctcag
aaaagttttaacattgcacaagtgtccaaaatctcacagatgacctctgtttcctcagtc
acaaaaggaaacaagaaaaatggaagctcaacacccaaactcaaacacaccattatccct
acaccaatctcatctgaacatgaatatttcacaacaattcttgccagatcagaagacacc
acactttcatctccacagtcaatttcctttacaacagcagagattggaaaaccgacagat
tcctccttgatgaaagcatggaaaagttccagtaaatatgaagacatacattcaacaaaa
gaacacagaattagccagactaatgtacccacaactctttctcttgtcacatctgtggca
aaagatatatctgctggcagtacattcctttccaagttacaccattcaatatcagaggac
acttccactggaatctccaccaagtactcaagatctacaaccaccacagaatcagaacag
actgcaaccagccacagagaacatactgtggtgacatcaaacatggtaacttccaaagat
ctatcaaccacttcttcaaacacagagacccaacacagtggaacacagacatttacactt
tcagaatccatggttaattctactaacatcaaccctgcaaccacattaaggactaattca
gtttgggaagggtccatgcctacaagttcgacaagaactccagatgaggcaccctcacat
tctccagtttctgccaatgcagacagatacagtacgccctcttctgtttctgcctccatt
gtcacaatttctaaggaaccaaatcctactagattatatgtgatcccaaaatcagtgacc
ccttcaataccaagctccaacagtacccagttctccaaaatcccacagacaacctctgtt
tccttactcggatcagtggaaggcatgaaaaagagcactttcaaacatgctatcacacct
atatcagtctcacttgaaaaggaatcttttacaactattctgccaaccatggaacaagcc
agactgtcaccttcacagtcagtctcatctgaaaggacagatactgagagaggtatatct
ttccccttgaggacagcatggacagatttcagtacatctgaacagataaacacaagcaca
gaatacagcactagccatactgaactttccactagcccttctcctttagaatctaggaca
ggacttacgtctgctgacagcatatccatttcagaccttcaatcaacattgcaagatact
tcctctggaacctccattagtatccctgcctccactgtcagtgcagagtcagaagagatg
aaaagcagacccatgggactctatccagttatctcagatattttgacttatccagattca
tcaagcactgtctctgtcaagggtacccactccagtgggacacatacatttccacattca
gaatccagggctcctttcaacaatcttgcttcagcatcatggacacctacccctgagaaa
ggtaccatatctacagattccacaaaaacacaagagtcactttcactgactgctgatact
tacatgccacacactcacagtagtcactctcctgattctgttgtctcttttttcacaagt
tctaaggattcaatcccaacagattcgtacacaagcttaggccctgtgactgtttacgtt
ccaagctggagcagcacctctcagtcaagctccaacactgttcatgcttcccaaatgtca
cagatgaatacattttcctcagtcacatcagggtctaacatgggagacagccattctgta
cctgaattcaaatacaccaccacatctgtttcagtgccatctgaactttccactgaaaag
aaaactttccccactaccctgcccactacagaagtagccacacttatacctacaaaatca
acatcatatgaaaatacaagtagtggcacaaagacagttaccctcctgaccacactgaca
caagctaactcacctgagaaggtgcactcaagcacagatttcattagacacccttctgaa
gtacctaatagttcctctactcctgtatcaagtacaagatccatgtctcctgataacgca
atactcccaacactttggcactttacatcagaacacactgggtttacaccagaagatatg
accagtggaactgtcaccaagtgttatgactccaacaccatcacagagtcacaagaagta
tctaccagccagattagggattctaatgtgacctcaaacattgccctctccctaaaaacg
tcaaccatgtcatcagagtcagacaatttcatgagtttcagtccagcccccacaattaca
gagacatctacatttgtaagccaaagttatgaagtcccatcaattgcaaccttttcaact
ctaaaaggaagcccactgggcaattctccaggatatcttaatgaatcttccttaacatcc
tctgttacttccacaggagaaaacaacaccccttctcctagtcctgttgtctcagtcttt
acctcctctaaagagaaaatcacaactagattggataaaccattacataatctgtctact
tcattttcaaattggaccactaatacacatacaagccaagagacttctcaggctaccgaa
ttttcacagacaagctctgcttcctctgttaactcagaaataattacagaagtcagcagt
tctataccccaacccaaattttctgtttcagaatccattagagctggcagaaccctgacg
agaagccctctttattcctcagaatcagaagatatcactcctggaagcatttccagactc
attacctaccctagcacagaacacatagggctaacctccatctttggaacagctaattct
gggtctttactaagtgatagcctatccagggatattgcagctactgttcctatgaaagaa
ttttcttcacctgagcctcaaacatctccacatttatcttggatatctgagtctcacagt
tttgaggaacagtcacaaacaagttctttatccaagggaaaacacacctctacagatccc
acatcaactatgattgagaaaactacactttcacctgttacttctacctctcaaggacaa
aatgtctcctcccttgatttcctggctgcactagtaacttctattcatgaaacaaactca
aatggacaagacacaagtgcaacttctgggagcaactcaattcaaagcctggatactata
gggctttcaactccaggttcttcatataacatgaaaacctttcagacaagtcacatttcc
ccaaaaaatccggcaacaagagtagaaactgatagtcctgcaatgcatccccaaggcact
gtcctagttaattcagttccatcaagaataacagaaattatgatctcacaaagcaattgg
gacacaatttccccatcaatgcccttatctagtcctgtacatgcagaaactcagaaagct
ttccccataacttcaatagaacaggaaaccaccaggtctgaagatactgatttaatgaaa
aaacatagttctggtcttcttacagtgtccactagcacataccctggaatttcaagaaca
gaagctaactcaactgatacaacatccacttcaaattctgtatcctttgcaaagacaaca
gacacctcagtgggaaatgcctccagtagctctacacttttctttccaaggactgacatc
agtcaagtagttaatgttgaggaatcatccaacatcaccactcttttgaacacatcagat
cctataacttattctggggctctctctactgtaactcagacatttttacattcagactca
atctctcatcccagcagttctgagttactctcatggacagactctccactccatgaagca
acttcctctgtgaattctatagaaactatacatacatcatcttttcctgttacttctcca
tcagaaggacaagggctcttctttccctcttctgaggaaacaactacagaggagttggac
acaaacttagctttctttaaaacttcatttccaagctggagcaatagtgaactagcaatt
tcaaaggacaccagaacctcacaaaaatcttataattccaccaaaactgaagtgagccct
gtaaacataactacatctgaacctccggcccaatacactgtatcacctgagactctttcg
gcagatagtactgcctcttccttgttgataataccaaccaagatttctgcttctgcttct
cctctattaccacagagatcaaactccacttcttttcctaagacttcattccccacttct
gaattgtttaagacaacagatatattggatagaagcttggaaactggaataagtttacct
ccaaacttgagaagcacatcacttgaaatactgggtttatctgaagttgttactgataca
gaaaaacatcattcttcctcaagtttcacagtaaccaatgtgaatactattactgtgggt
catgaactaagttcctctgtatcaacactctctgagtcatctagagacgctgatacatca
ggaactcctccctctgtatgggtgactactatactcacatcattgcctaaccatttagaa
acaacaagatctaatactgattcattttcccatttgacttctggattgagggacactagc
atatccctacaaacaaacaaaccttcacctcttgaatccactctccacttgccaagttct
gagactgatgttgctactgctgtgaatataccaaccccatatcagagtccatctccaaag
ttcactgacattccaatagcaacagctaccattttaaatccttcctcatctattgtagag
tctactggggcaacatccttcccggaatatgattttactatgctttcacgagaaaatatc
catgttccaagaactgatatactgccttcagctgaaaccactttgattgacacaacagca
acactttctcccagagggatgaccttctttgccacaaccagtaacccaacaggcatttca
gctgtgacttctgagagttcccattctatgatacagtcaagccatttgtttgctaccatt
gtaaaaaagccaccttcttcaatttcaacaccattgccctatcctatttccactactact
gacactgcagccagctcatccctccagaggattactactccttcagaaatggaagatggc
atgcaataccacacagacatatctaatggagctgtccatggagacactgcaggcctgggc
aagggttctctggcttctacatcatctgctaaccataaagatctaaccacagaggggaca
gtaaaagcagacactactaccagagctctgaaggcctcttccattttcactccaaacacc
aaaatgtcaactacaatttcaacacccccgactcacatcaagacatcaaagaaaacaacc
aacatcaacacaacagagatgattatcacagcctcagatgcttcccacaacttactagag
atggcaccatcattttccacaggccttagagaaaatattagcatggttgccaggacaagc
ccatcttcttacagtagaaaaccagaaattacaatcccccagattcccagtcttaagaca
aagaccatcccaaatgttaatactttgacagtctcctctgctgagtctgatacaatctca
tggattacccatgctttagagattacttcagctattgccaagacaaccaaaaatgcttca
caagttgaattagattccaaggtgtccacagccaccagttccagaggaaaagacaggtca
accctttcaacagcagctgtttcctctgccataccagatttggcatctattgaacaagaa
gacagattgtttggtccaactatatccatctcatctagtattcctgatatgaaaaactta
gaaggctacagttctaaggaagatataggaacatctaaaccaattctgactcattcacct
tctgagccatataatacaatttctcttatctctcatgctgggggaaagactgattcaccc
atgtctactattgctgtctctccagatgtaacagaaataatgagaccactgttcacaagc
tctgggagaagaatccatacaagaaacccaacccaaggtcaatcagtgaccacctcatgg
atcacccatcctggaacagaagccacttcaagggtgttaactacaacaatatcacctaat
aatcaagaggtggaaacctcaaaatctgcaaatccttctaaactacagacgacaacttca
ttgataacagatagcaaggaacagcccagtttcaccatgtctactctggctgtctctctg
ggtgtaatagaaggaaccccatcaccagttattaacaggggcacagaaaggaattcaagg
actgcaactctagactttttcctagacctaccagagaccacaacctcttggaccactaac
cctgaaaaagaagccatttcaggcattctaactacaaagtatgcacctagtgttacagac
aggatgaccacaataaacctgaaccatactcctcctgaaccacagaacataacatcatta
gctactcattatgtaagacacagtttaatcacatctaccaaagttgtccatccagatata
gaagaagtgaaaccatcacaggtcactagctcagtcacagaaagtcatgtaatgacttca
aatatggctttttcaccaggaaaacatgaaactataaacccattcgtcacacatcctaga
agaaaagtaacttcagggattctaactgcagccatctcacctagtgttaccaacatgatg
accttcacacctgtgaaacactctccttctgaaccacaacccatagaatcattggacaca
aatgctgagggacatcccagtgcatccatgtctacacaggctctctctccaggtatgaga
gaaatgatgataccacaggcccctaattatggaagagaaacatatatcaccacttcaact
cttcctgtttctgtaggtcaaatagagtccacagcctcattggtgactcatgcagaaaaa
gaagcaactttgggggttttacctactaccgtttcaactattagtccaaatatgatggct
tcaacagaacttatgtcttctggaccacacaccacagcttcattggtcacccataatgga
gaacaacatagttcagatatgtctacactgcctgcctcttcaggtataacaaaaataaaa
caatcactggacactaccacaggcaaagaaagccagtcggtcattacaactctagctgtt
tccctaggcataccaaagactaaatctataaacacaacatcaaatgttccagacatgatg
atctcaaaatcttggaaccatacttcttcgaatgtgcacaccataacatcactggttacc
catgctgggacacagtccagtttttccaagtctactaaggcagcctctccaagtataaca
aaattaacagcatcactgttcacagacacagacacagaaaatgttgcaataactgctctg
cctacttcttcaggtcaaatggaaaaaagagcaccatcagtcaccaaacctgaaaaagaa
accatttcagacgtcttatctatcaccacttcaactagtgttcaacaaatgatgatctca
ccaactgttattccttctgaaccacataccacagtttcattcgatacccatgttgggggg
caacccagttcaaccatgtcaattctaccagtcacttcagattcaacaaaaatcatatca
tcactgggcacaagatctggcacagaaagccattcagtgacttctactatggatatttcc
caaggtcaattggagaccacagcctcaggagacacccatactgaaagagaaggcaattca
cttacactatctacagtcatctcaactagtgctccagacataatgacctcaacaaatgag
aatcaaacttcttctgatagacagaccataatatcattactcacccttgctggagaagac
acaagtttatctgtgccttctcagggtggctctccaggtataatgaaagtgacaccatca
ttattcactgatgtagggacagaaggctatgcaataacttcaactctgcctgtgttttca
ggtcaaccagacactagaacaccatgggacaaacattctgaaacaaaagtcactacagtg
gtactacctaccaccatttcaactagtgttccagaaattatgacatcaccaactcctatt
ccttctgaagcacataccacagtttcattaatcacccatgctgggggagcacccagtttg
gctatgtctacactgcctgtctcaggagctttaacagaaaacataccatcaaaggtaact
taccgtggcaaagaagggaattcagttacttcagctctagatgtttcctgggatcaaaaa
gaatccacagctccatgggtctcctatcaggcaaaagaaggaccttcagaggttctttct
acaaacatctcaaccagggctccagacatggtattttcaacaaataagaatcaaacatct
tctgatacacagaccatgacatcattaatcactcaaactggggaacagaccagtttatct
gagtctactcaaggtgtgtcttcagctataacaaaaatgacacaatcgatattcaatgac
ttgggcacagaaagctatgaaatgacttcaactctgcctgcttcttcacatcaatcagag
actagaaccaaatggatcactcattctaagatagaacaaatgtcaggagttctatctaca
acaaattcttctagtgcaccaaaaatgatgacttcaactcctattacttctgaactacat
gccacagtttcattagtcacccatgttggggcacaacacagttcaaccatgtctgctttg
actgcatctccaggtaaaacagaaatcatgccttcagagcaaactcacactggcacagaa
atccattcagtgacttcaactctggatgtttctgcaggtcaagaagaattaacaactgca
tgggtaacccaatcagagaaagaaagaacttcaggggttctttctacagcaatctcactt
agtgttccaaacatgacatcagcaacactaaacaataattctcttgatatacggaccata
acagcttttatgaaacatcctgcgggaaagtccagtttatctatgtccactgagggcatc
tctcccaggataacagaagtgacaccatcactattcactgacttaggcacagaaagctat
gcaatgacttcaactatgcctgcttcttcaggacaatcagagactagaaaatcatggaac
actaattctgaaatggaagccactcctggagttctatctactagcattacaaccaatgtt
tcagaaatgattacctcatctactagttttccttctgaaccacataccacagtttcatta
gtaacccaacttgggggaaattccagttcacccatgtctgctctgcctgcttctccaggt
agaacagaaatcaagtcatcactggtcacttaccctgacacagaaagctattcagtaact
tctactctggatattttcacaggtgaagcagaatccacaaccccagcaagtacccatact
ggaagagaaggcacttcagagactgtaactagaaacacctcaactagtgtaccagatatg
atgacctcaataactaagaggcactctgcctctaatacacagatcatggaatcactggtg
gattccatggaaatccaccatggaggaaagcccagtttgtctgtgtcttctcagcatgtc
actccagatataacagaagtaacacaatcactcttcaccaacttgggctatgaaagaaac
acagtgattcctactctgcctgtatccccaggtcagccagatactcaagcaacatgggtc
attcactcagaaaaggaagcaacctctagagttctacctacctccacttcaccccatgtt
tcagaaccgaaggcctcaccaactgatattccttcagaaccacaaaatacagtttcatta
ctaacccaagttgggggacagtccagttcagccatgtatattctgcaaacctctacaggt
agaacaaaaatcaaaccatcagtggtcactcaacctggcacagaaagctttgcaatgctt
tcgactccagatatttcccaaggacaaacagaatccgcaacaccttggcccacccatcct
cctaaaaaagggacttcagaagtactatcaacaaccatctccaacagttctccagctaca
atgacttcaataactaagaatcaaacttcttttgattcacaaaacataacatcatttatc
acccatgctgaggtacaacccagtttatctgtgtctatgcaggatatctctactggcaaa
gcaaaagtgtcaacatcacaattcactgacttaggtagagaaaactgtgcaatgacttca
atgttgcctgctttatcaggacaagtagaaactaaagcaccatgggacactaattctgaa
atggaagggatttttgggcccgtatctaccattatttcatctagtgtcccagaaatgatg
acctcaccaaatgttattccttcagaaccacataccaaagttccattatccaaccatgat
gtggggcaacccacgtcaataatgtctactttgcatgtcttgccaagtataccagaattt
aaaccaaaactggacactagctatggagcagaaagccagtcattgacttctacaatgggg
attttcgtagatcaagcaagatccacaaacacatgggcaacccatactgggagaaaagac
acgtcaggaattgaatctagattaatctcaacaagtgctccagagatgatgacttcaata
acaaagaatcaaacttcttctgaaacaaagaccataacaccatatgtcatccaggctgga
ggagaaagcacttcagggactgtatctaaaataatctcaaccagtgcacctgagaaaatg
aattcagtaactaagaatcaaacttcttctgatacacagatcacccatgctggagaacag
cccagcttatctgtgtctacacaggatatctctcccaggataacagaagtgataccatca
gagttcactgacataggcccaaaaaggtttgcaatgacttcaactttgcctgcttcacca
ggtcaagcagaaactaatgggaccattacaccatggaacagtaattctgaaatggaagct
acttctgggcctttatctacaactattttacctggtgttcaggaaatgatgacctcacca
tctgtatttccttcagaacaacaaactacagttccattagtcagccattatgtgggacaa
ccaacgtcagtcatgtctactctcccattctctccaggtagaacagaaaatatgccatca
ctggtctctagctctggtatacaaagtcattcagtgacttcaattaaggatacttctgta
aataaagcagtatccacaaccacatgggccacacatactggaagagaaaacacttcagga
actgaatctacattaatctcaactagtgctccagagacgataacttcaataaccaaacat
caaacttctgctgatacacagaccataatgtcattcatcacccatcctgcaggacaaccc
agtttatcggtgtctccctatggtgcctctcccgggataacagtagtgacaccatcacaa
ttcagtgacttaggcacagaaagctatgcaatggcttcaactttgcctgcctcaccaggt
caagcagaatctaagacaccatgggacactcattctgaaatggaagccacttctgggcca
gtacccactactatttcacctggtgttttagaaacgatgacctcaccaacagttattcct
tcagaaccacctactaaagttccattagtcacccatgttgtggggccatccacttcatcc
atgtctactttacatgtctctccaggtataccagaaattacaccatcagtggtcactagc
tatggcccagaaagccattcagcaacttctacacaggttatttccatagatcaagcagga
tctacaaccacatggtctgcccatactggaagaggaaatacttcaggaactgaatctaca
ttaatctcatccagcggttcagagatgatgacttcaataaagaaaattcaaacttcctct
gaaacacagaccataacttcattcatcactcatgctggaggagaaagcacttcagggact
gtatctacagtaatctcaaccagtgctcctgagatggtgaattcattaactaagaatcaa
acttcttctgatacacagatcacccatgctggagaacagcccagtttatctgtgtctact
caggatgtctctcccaggataacagaagtgacaccatcagagttcactgacttaagctca
aataactatgcaatggcttcaactttgccttcttcacctgggctagaagaaactaagact
ccatggaacagtaattctgaaatggaagccacttctgggcatttatctaccactatttca
catggtgttccacaaatgatgacagcaacaactgttattccttcacaaccacatagtaca
cttccaatagtcacacacattcctgggcaacagacttcagtcatgtctatttttcctttt
tctccaggtagaacagaaagaatgccatcactgttccctagcccaagtagagagaaccat
ttagtaagttctactcaggatatttctattgatcaagcagtatcaacaacaccatggccc
aaccatactggaaataaaatcacttcaggaactaaatctacattaatctcaacaagttct
gcagagacaatgacttccataactaagaatcaaacttcttctgctacacagacatcattc
atcagtcatgctgcaggagagtcaagtttatctgggtctacctatggtgtctcctttggg
ataacacaactgtcaccatcacaattcactgacttaggcacaaaaaactatgcaatgact
tcaactttccctgcttcacctagtgaaatagaaactaaggcaccatggaacactaattct
aaaatggaagcctcttctgggcccttatctaccactatttcatctggtgtttcagaaatg
aggacagcaccaactgttgcttcttcagaaacacatactaaagttgcattagtcacacac
attattgggcaactgacatcagtcgggtctactctccctttttcttcaggtaaaatagaa
aatatgccatcactggtctctagctctggcatacaaagtcattcagggacttcaattcag
gatacttctgtaaaccaagcagtatccacaaccacatgggccacacatactggaagagaa
aacacttcagggactgaatctacattaatctcaactagtgctccagagacgataacttca
ataaccaaacatcaaacttcttctgacacacagaccataacgtcattcatcacccactct
gcaggacaacccagtttatcggtgtctccctatggtgcctctcccgggataacagtagtg
acaccatcacaattcagtgacttaggcacagaaagcaacacaatgacttcaactttgcct
gcttcaccaggtcaagcagaatctaagacaccatgggacactcattctgaaatggaagcc
acttctgggccagtacccactactatttcacctggtgttttagaaacgatgacctcacca
acagttattccttcagaaccacctactaaagttccattagttacccatgttgtggggcca
tccacttcatccatgtctactttacatgtctctccaggtataccagaaatttcaccatca
gtggtcactagctatgtcccagaaagcctttctgtggcttctacaatgagtattttcatt
gatcaagcaggatccacaaccacatggtctgcccaaactggaagaggaaacacttcagga
actgaatctacattactctcaaccagtgctccagagttgatgacttcactaacaaggaat
ccaaattcttctgaaacagaggctataacatcattcattacccatcctggagaagaaagc
acttcagggactgtatctacaataatctcaagcagggctcctgatgtgatgacttcagta
actaagaatcaaacttcttctgaaacacagaccataacatcattcatcacccatcatgga
ggacagcccagtttatctgtgtctactcagggtgtctctcccaggataacagtagtgaca
ccatcagagttcactgacttaagctcaaaaagttatgcaatgacttcatctttgcctact
tcacctgggctagaagaaactaagacaccatgggtcagtagttctgaattggaagccact
tctgggcctttatctaccactattttacctggtgttcaggaaatgatgacctcaccatct
gtatttccttcagaacaacaaactacggttccattagtcagccattatgtgggacaacca
acttcagtcatgtctactctcccattctctccaggcagaacagaaagtattccatcagtt
ttccctagctctggcacagaaagccattcagtgacttctactcaggatacttctatagat
caagcagtatcaataaccccatggtctaccctcactggaagaggacacactctaggaact
gaatctccattaatctcaaccagtgctccagagacaataacttcaataactaagaatgga
acttcttctgatacacagaccataacatcattcatcacccatcatggaggacagcccagt
ttatctgtgtctactcagggtgtctctcctgggataacagaagtgacactgtcacaattc
actgacttcagcacaaaaaactatgcaatgacttcaactttgcctgcttcaccaggtcaa
gcagaatctaagacattatggaacactaattctgaaatggaaaccaattctgggccttta
tcttctaccatttcatctgttgttcaggaaatgatgacctcaccaacagttatttcctca
gaaccacatactaacgttccattagtctcttctgatgtggtacaatccagttcatccatg
tctactctgtctgtctctccaggtacaccagaaattacaccatctgtggtcactagctat
gtttcagaaagccattcattgccttccactctgccagtttcttcaagtcaatccaaatcc
ccagcccaatggatcacccatactgggcatgaaggggcttcagggaatctatctccaacg
atctcacctagcgttccagaaattatgaccgtaacaacattaaatcatactcttcctaaa
tcactgactataacatcattgtctactcaagttggtgtccaaccaagtttaaataggacc
accacagcattttctccaagtataccaaaattgacatcactgagtacaaatttgggtata
gaaagccaccataccactgtgtctttgtctccaagtctatcagagactatagcatctttg
gtgactcattctcaaaaagaagctagtttaggtgttctaactactaccattccatctact
attctagacacgatgacttcaccatctcttcttacttctgaatcatataccacaatttca
ctgaccacccctcttgagggacagcctagttcatctatgtctactctggctgtttctcct
ggcgtaacagaaaagataccattactagtaactagttctagcacaaacacccattcagtg
tcttcaactctgcatgcttctccaggtcaactagagacccctgccttgatggtcacccct
cctgaaagagaagccacctcaagtattctaagaacagacatctctcccagtattccagac
ttgatggcctcaaaaactcataatccttctgaacataccacaatatcatcggtcacctat
gttgggggacaatccagtccaagtatttctactctgactaagtttcctagtataaaagat
ataatgacaccactggccactacctctgtggtagagacacataaaactgctccaactctg
tctgttcctgcagatcaaagagagaccacagccttgtgggtcatccattctggaaaagaa
ctcatgtcaacagtttccagtccacctactttacctggtgattcagagaggactgaaaca
tggctcatactttctgccaagaccagcaccccacaccccacaataacttccacattttct
tataatgacatcacttcctcagtatctgaggtagagaccagctcagccacaactctttca
tctggtgcttctgaagaagcagcctctctctctggccacactggcactgagacaagcaca
tccactctaactgtaaccccttcgtctacttcaccaggaaccacaggcttacagccttcc
agcccttccaaagaatatactctgactatgtcctctagtcttcctgtgtttcctgatcat
tctacaactagtaaatttggtattgcaacttcaaagaatatagaaacttcaccatctctc
agtacagttagactttcggattttgtcagtgatgtcataagccctgccatgaccttgtca
tcagagtcttcaacacatgcacccactgacctggaaactacacgtgaaaccactcattca
gctactacaagttcaaaacccactggggataagactacaacttcactacatgaaagttct
tctgcccttctgaccacacgtagaatatctacattgtcccctgagaatgtgacttcaagg
ccaactacaaacccatctctagtgcccttcaccctcaatttcactataaccaacctgcac
catacagagggcatggcatctcaaggatctgaaatattcaacagcacagagaggatcttg
aatagcctgctcaagcccatgttcaagaatagcagtattggacatctttattctggttgc
agactgatcaccctgaggcctgagaaagatggaacagccactggagtggatgctgtttgc
actctccattctgatcccttgggcctgcagctggacagagagaagatgtactgggaactg
agccataacacccagggtgtcaccaagctaggatccttcactttagaaaaggacagtctg
tacatcaatggttttacacatataaaaacctctgcttccactctcaacactccggtgact
tcctctctgtttttcactgagacctccactgcaaaacctacactctctacagtgcctggc
tctcctctggtgcctttcatcatcaacttcaccatcactaaccttgaatatgaggagggc
atgagtcacgctggctcctggaagttcaatgccactgaaaaaatcctacaaagactgctt
tggtctttgttcaataaaaccagtatcggcctcctgtattctgactgcagactggcattg
ctcaggcctgagaaagatggagcagccacaggagtagatgccatctgtactcaccatgca
ggcccaattggacctgggctggacagtgaacgagtattctgggaattgtgcaacctgacc
aacaatgtcactaagctgggcccttataccttagacaagaacagcctttacatcaatggt
tatacacaccagatccagtccatcacatctccaaccacaagcccctctctgctacccttc
accctcaatttcactataaccaacctgcagcatacagagggtatggcatttcaaggatct
gaaatattcaacaacacagagaggatcttgaatagcctgctcaagcccatattcaagaat
agcagtattggacatctttattatggctgcagattgatctcgctgaggcctgagaaagat
ggaacagccactggagtggatgctgtttgcactctccattctgatcccttgggcctgcag
ctggacagagagaagatgtactgggaactgagccataacacccagggtgtcaccaagcta
ggatccttcactttagaaaaggacagtctgtacatcaatggttttacatatacaaaaatc
tctgcttccactctcaacactccggtgacttcctctctgtttttcactgggacctctact
gcaaaaccaatcctctctacagtgccactctcttctctggtgcctttcaccatcaacttc
accatcactaacctcaaatatgaagagggcatgaatcaccctggatcatggaagttcaat
gccactgaaagaatcctacaaagactgctttggcctttgttcaataagaccagtatcagc
ctccggtattctaactgcagactggcattactcaggcctgagaaagatggagcagccaca
ggagtagatgccatctgtactcaccatgcaggcccaattggacctgggctggacagtgaa
cgagtattctgggaattgtgcaacctgaccaacaatgtcactcagctgggcccttatacc
ttagacaagaacagcctttacatcaatggttatacacaccagatccagtctatcacatct
ccaacagcagggcctgtcctggagcattttactatcaacttcaccatcattaacttgaag
tttgaggaggacatgagtcaccctggatctagaaagttcaatatcactgaaagaaccctt
cagagattgctgaggatattgttcaaaaaatccagtgtcggagccctgtattctggctgc
aaactctccttgctcagacctgaaaatgatggtgcaggcacaggagtagatgctgtctgc
actcactaccctgatcccactggccttggactggacagaaagatgttatatggggagatc
agcaggctgacctatggtgtcaaaagattgggcccttacactctgaatgacaaaagtctt
tatgtcaatggttacacacatcagattgtggctaccactactcagatggcaatgatgacc
attgcttctatggggatgataaacaactctcccagtcctacagcaggttctgggctggtt
ccttttaccatcaacttcactgtcactaatctgaagtatgtggagaacatgcatcaccct
ggatccaggaagttcaacaccactgaaagaatcttgcagaaactgctcaaagcattattc
agtaaaaccagtgttggccccttatactctggatgcagactgatcttgctcaggcttgag
cacaatgggactgccacaggagtagacgccatctgtacctaccaccccaacatttctaat
caagggctagacagagagcgtgtatactgggagctgaaaagactgaacatcacgcagcta
gggccctacatcgtggacgaaaacagtctctatatcaacggttatacacaacagattctg
tccaccacctccaggccttcagtgatggccactgtttctgaaggaatgccaaacatttct
tctaccccaacagcaaccagccctgtcctggtacctttcaccatcaattttaccatcact
aacctggagtttaagaaggatatgggtcgccctggatccaggaagttcaatgtcactgag
agaaccctacaaagcctgctcagacctttgttcatcaaaaccagtgttggtcagttatat
tctggctgcaggataaccttactcagaccagagaaaaatagggcagccacaggagtggat
gccacttgtacctaccacctagaccctgctggccacaggctggaaagtgaacagatatat
gaggagctgagcaatctgacccagagtgtcacccagctgggcccctatatcctggaccag
aacagtctctatgtcaacggttacacagaccagatcctggctactacccccagagccttg
agctctgctctgctaaggtgcactcttaacttcactatcactaacctaccccacacgaat
gacatgtgggtcccgggatcagccaagttcaataaagtggagaaaatcctgaagctcctg
ctcaaacccttgttccaaaacaccagtgttggcctgctgtattctggttgcagactgacc
tcactcaggccaaagaaggatggagaggctaccagagtagacatggtctgtacttaccac
ccaaacaccacaggaactggtctggacagagagcaattatacttggaacttgaacaactc
acccacaacattactcaactgggtccctatagccttgaccagaatagtctctatgtcaat
ggttacacacaccagactgcagtaaccagccccagcaaatcacccttggagatatttacc
ttcaacttcactatcaccaatctactgtacacggagaacatgcagcccccaggatccaag
aaatttaacaccatagaaaagatcctgcaaggcctgcttggatccttgtttaagaacacc
agtataggccctttgtacactggctgcagactgacttcgctcagttccaggaaggatgga
aaagccactgaagtagacacagtttgttcctattacgctgaccacatgggtcctgggctg
gccacagagcaactctacctggagctgagcaacttgacccatggtgtcactaaactgggc
ccctacactctggatcaggacagtctctatgttaatgattacacatattcagcctcaagt
atcttccataatacttcctctctggttccatactctacaaacaattccacaggcaacggt
actgtcatggtatccattactctcaacttcaccataaccaacttgcattatacagaggag
atggggcatccaggttccttgaagttcaactctactaagtggaccttacattattggctt
gataccctgctcaataagaccagtattgccccactctactctggatgcagattggcttca
ctcaggtctgacgatcatagagcagccacagaagttgatgtcatctgtaacttccactct
tactccatgagtcctggagtaaaccaagatcaactattttgggagttgagccatgggacc
catggaatcacccatctgggcccctacaccctggaccagaacagtctctacataaatggt
aatagttttggagctgcagcaccaaataccaccactggagaactcagtgaggagctgttc
acagtgaacttcaccattaacaacctgcgctactcagctgatatgagtcagattggctcc
cccaaattcaatatcacagatacactcatgcagcacctgctcggccctttgtttcagagg
agcagtcttggccccctatacacaggctgtagagtagccactctaaggtcaatgaagaat
ggtgcccagacccaagtagatgtcctttgcacttaccgccgagttttcaacagtcaggga
ctgcctgccaagccaattttctatgacctaagctggcagactcatggaatcaccaagttg
ggtccttactccttggataaagacagccttttcatcaatggctacaatgaacctggtcca
gatgtacctcctacaactccagagccagccaccactatcttgccctccccaacaacatct
ttgcagccagagtccaacacagttatgtggcacaagccggaaaccttcacaatcaacttc
accatctccaaccttccatattcagtagacatgatcagtggctcagccatattcaactcc
actgagaatgtcctacaacgcctgctgggacccttgttccaaaatgactccttcaactca
agttgcagactgacctccctcaggcctgagaagaatgggatgttcacaggtgtggttacc
acctgcacctaccaaaatgaccctgcacatcctggaatggacatacagggtctatactca
gaactgagtcatctgagccatggagtcacccagctgggaaactacacactggaggagcat
agtctctatgtgaatggttaccccattcttggtccagacatacttactacaactcctgag
ccaagtaccaccatcctgccttttacactgacatctgtgcagccagaatccaccacagct
agagcgcaccatctgaagaccatcacaatcaactttaccatctctaatcttccatattca
gcagaaatgaactatagctcagccatgttcaactctactgagagtgttctacagcacctg
cttagacccttgttccagaataactccttcaacgcaagctgtagactgacctccctaagg
cctgagaagaatcaaaactcaactaatgtgaatgtaatttgctcctaccaacattactct
gcacatcctgggctgcacacacaggagttgtattcagagctgagccatctgacccatgga
tttactcaactgggcaactatacattggacaaagatagtctctatgtaaatggttataat
gaaattggtacaaaagaaccaaccacaaatcctgaaacagccactactatgctgccttcc
ccatcaatacttgtgcaaacagaatccaccacagctgtggggtaccatttgaagactgtc
acagtcagcttcactatttccaatcttccatattcagcacatatgaacaatggctcagct
gtgttcaactctactgagactgttctgaagcatctgctggaacccttgctccataatggt
tctttcaactccagttgcagactggattcactcaggcctgaaaaaaatggaacagctact
gctgtagaagccatctgcacctactaccataacgctgcaaattctgggattgacacccag
gaactgtactcagagctgagtcatcttacctatggaatcacccagctgggcaactataca
cttgaccaagaaagtctacatgtcagtggttataatgaacctcatccagaagaacctcct
acaactcctgaaccaaccaccactatgcaaccttctccatctacagctttgcatccagaa
cctaccacagggcaccatctaaagattcttacaatcaacttcaccatatccaaccttcca
tatttatcaaatatgagcaatggctcagccatgtttaactcaacagagagtgtcgtgcaa
tacttgcttagtcacttgttccagaatggctccttcaattcaagttgcacactggattcc
cttaggtctaggaagaatggaacagccactggtgtgaatgttatctgcatctaccaccat
gaccctgaaaatcctgagatggacatccatgggctgtacctagagattaacaatctaact
catggaatcacccagctgggcaactactcactggacaatggtagtctatatatcaatggt
tataatgaacatggtgtagaagaactttatacagctccagagtcacctagcaccattgtg
ccttcttcatcaacatttgtgaaaggagaacccactgtggctatggggaatttgaagact
ttcacactcaatttcaccatctccaacctcccatactcaacagacatgagtagtggctca
gccatgttcaattccactgaaaggatactgcagcacctgattagacccttggtccagaat
gaatccctttactcaaattgcagactggcttccctcaggcctaagaagaatggaacagcc
actggggtgaatgctatttgctcctatcaccaaaacccagaccatcctgagcttgacact
caggagctgtatacaaagctgacccagctgacccaaggagtcacccagctgggcagctac
atgttggaccagaatagtatctatgtcaatggttacactcaccagactgcagaaactaca
tctagtggctatgtgccactgaatataaccatacagggcaagtaccagctaaacttctgc
atcatcaactggaaccttaacaacacagacccaacatcttcagaatatattaccctagag
agggacatcgaagacaaggtcaccacactctacacaggcagccagctaaaagaagtcttc
cagtcttgcctggtcaccaacatgacgtctggctccacagtggtcactcttgaggcactg
ttctcctctcatctggatcccaaccttgtgaagcaagtcttcttgaataagacactgaat
gcctcctcccactggctgggtgccacctaccagttgaaagatctgcacgtgatagacatg
aagacatccattcttctgccagcagaaataccaacaaccagttccagttctcagcatttc
aacctgaacttcaccatcaccaacctaccctattcccaagacatagcccagccaagcacc
accaaataccagcaaaccaaaagaagtattgaaaatgcgctcaatcagcttttcagaaac
agcagcatcaagagttacttttctgactgtcaagtattagccttcaggtctgtctccaac
aacaacaaccacacaggggtagattccctatgtaacttctcaccattggctcggcgagta
gacagagttgctatctatgaggaattccttcgaatgacgcacaatggtacccagttgctg
aacttcacactggataggaagagtgtctttgtggatgggtattctcaaaacagagatgat
gatgtgatgaagaattctggtcttcctttctgggctatcattctcatctgcttggcggta
ctactggtactcatcacgtgcctgatgtgctgtttcctggtgactgtctgcaggagaaaa
aaggagggagactaccaagttcaacgtcatcgtctagcttattatttgtctcacctggac
ctgaggaagttacagtga

DBGET integrated database retrieval system