KEGG   Mus musculus (mouse): 73737
Entry
73737             CDS       T01002                                 

Gene name
Bbln, 1110008P14Rik, C79326
Definition
(RefSeq) bublin coiled coil protein
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: UPF0184 EzrA PhaP_Bmeg ATP-synt_D UPF0242 T3SSipB
Other DBs
NCBI-GeneID: 73737
NCBI-ProteinID: NP_932118
MGI: 1920987
Ensembl: ENSMUSG00000039195
Vega: OTTMUSG00000012952
UniProt: P58686
Position
2; 2 B
AA seq 83 aa
MSGPNGDLGMPVDAGTEGENDSFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELL
ESNRQTRLEFQQQLGEAPGDASP
NT seq 252 nt   +upstreamnt  +downstreamnt
atgtcgggccccaacggggacctaggcatgccggtggatgcgggcacggaaggagagaat
gacagcttcggggaagcagagtatgctgccatcaactccatgttggatcagatcaactct
tgtctggaccacctggaggagaagaatgaccacctccatgcccgcctccaggagctgctg
gagtcgaaccggcagacgcgcctggaattccagcaacagcttggggaggcccctggcgat
gccagcccctag

DBGET integrated database retrieval system