KEGG   Mus musculus (mouse): 73754Help
Entry
73754             CDS       T01002                                 

Gene name
Thap1, 4833431A01Rik, AW490810
Definition
(RefSeq) THAP domain containing, apoptosis associated protein 1
  KO
K23203  THAP domain-containing protein 1/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    73754 (Thap1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    73754 (Thap1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys3His zinc factors
    73754 (Thap1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Gene silencing
   Transposable elements
    73754 (Thap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: THAP Cep57_CLD ATG16 CALCOCO1 Sec2p MPS2 DUF16 CENP-H DUF4391 ADIP DivIC GrpE TMF_DNA_bd FliD_C FlaC_arch PI3K_P85_iSH2
Motif
Other DBs
NCBI-GeneID: 73754
NCBI-ProteinID: NP_950243
MGI: 1921004
Ensembl: ENSMUSG00000037214
Vega: OTTMUSG00000031061
UniProt: Q8CHW1
Position
8; 8 A2
AA seq 210 aa AA seqDB search
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKQWEAAVKRKNFKPTKYSSICSEHFTP
DCFKRECNNKLLKENAVPTIFLYIEPHEKKEDLESQEQLPSPSPPASQVDAAIGLLMPPL
QTPDNLSVFCDHNYTVEDTMHQRKRILQLEQQVEKLRKKLKTAQQRCRRQERQLEKLKEV
VHFQREKDDASERGYVILPNDYFEIVEVPA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagtcctgctccgcctacggctgcaagaaccgctacgacaaggacaagcccgtc
tccttccacaagtttcctcttactcgccccagcctttgtaagcagtgggaggcagctgtt
aaaaggaaaaacttcaagcccaccaagtacagcagcatctgctcggagcacttcaccccg
gactgctttaagagggagtgcaacaacaagctactgaaggagaacgctgtgcccacaata
tttctctatatcgagccacatgagaagaaggaagacctggaatcccaagaacagctcccc
tctccttcaccccccgcttcccaggttgatgctgctattgggctgctaatgccccctctg
cagacccctgataacctgtcggttttctgtgaccacaattacactgtggaggatacgatg
caccagaggaagaggatcctgcagctggagcagcaggtggagaaactcaggaagaagctc
aagacggcccagcagcggtgccggcggcaggagaggcagctcgagaagctcaaggaagtc
gtccactttcagagagagaaggacgacgcgtccgagaggggctacgtgatcctaccaaat
gactactttgaaattgttgaagttccagcatga

DBGET integrated database retrieval system