KEGG   Mus musculus (house mouse): 73804
Entry
73804             CDS       T01002                                 
Symbol
Kif2c, 4930402F02Rik, ESTM5, Knsl6, MCAK, X83316
Name
(RefSeq) kinesin family member 2C
  KO
K10393  kinesin family member 2/24
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    73804 (Kif2c)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    73804 (Kif2c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Motor proteins
     73804 (Kif2c)
  Centrosome formation proteins
   Spindle formation proteins
    73804 (Kif2c)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     73804 (Kif2c)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATPase_2
Other DBs
NCBI-GeneID: 73804
NCBI-ProteinID: NP_608301
MGI: 1921054
Ensembl: ENSMUSG00000028678
UniProt: Q922S8 Q3TTL2 Q3UD72
Structure
Position
4:complement(117016830..117039821)
AA seq 721 aa
MESLHARLFPGLSINIQRSNGLIHPANISTVNVEKSCVSVEWIEGGTTKGKEIDIDDVAA
INPELLQLLPLRPKDSLPLQENVTVPKQKRKSVNSKIPALKEGLRSRSTRMSTVSEVRIP
AQENEMEVELPVPTNSRKQFAIPSHPRASCSTVTELPLLMVSEEAEEQAHSTRSTSSANP
GNSVRRKSCIVKEMEKMKNKREEKRAQNSELRIKRAQEYDSSFPNWEFARMIKEFRVTME
CSPLTVTDPIEEHRICVCVRKRPLNKQELAKKEIDVISVPSKCLLLVHEPKLKVDLTKYL
ENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSG
KSQNASKGIYAMASRDVFLLKNQPRYRNLNLEVYVTFFEIYNGKVFDLLNKKAKLRVLED
SRQQVQVVGLQEYLVTCADDVIKMINMGSACRTSGQTFANSNSSRSHACFQILLRTKGRL
HGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPFRESKL
TQVLRDSFIGENSRTCMIAMISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQPVQMET
EVMEASSNGTSLTGNEEEELSSQMSSFNEAMTQIRELEERALEELREIIQQGPNWLELSE
MTDQPDYDLETFVNKAESALTQQAKQAKHFSALREVIKALRLAMQLEEQASKQINSKKRH
Q
NT seq 2166 nt   +upstreamnt  +downstreamnt
atggagtcgcttcacgcacgcctgtttcctggtctctccatcaacattcaacgcagcaat
ggcttaattcaccccgccaatataagcacagtgaacgtggagaaatcctgtgtttcggtg
gaatggatcgaaggaggtaccacaaaaggcaaagagattgacattgacgatgtggctgca
ataaacccagagctcctacagcttcttcccttacgaccgaaggacagtctgccactgcag
gaaaacgtaacggtcccgaagcaaaaacgcaaatcagtcaactccaaaattccagctcta
aaagaaggccttcgaagccgctccactcgcatgtccactgtctcagaagttcgaatccct
gctcaggagaatgaaatggaggtggagctgcctgtgcctacaaactctcgcaagcagttt
gccattcccagccaccctcgggcctcctgctccacagtgacagaattgccgttgttgatg
gtcagtgaggaggcagaagagcaagcccactccacccgcagtacctcatctgcaaaccct
gggaactcagttcggaggaaatcgtgtatcgtgaaggagatggagaaaatgaagaacaag
cgtgaagagaagagggcccagaactcggagctaagaataaagcgagcacaggaatatgac
agcagctttccaaactgggaatttgcccggatgatcaaagaatttcgggttactatggaa
tgtagcccgcttactgtgacagaccctatcgaagagcacaggatctgtgtctgtgtcagg
aaacgcccactgaataaacaagaactggccaagaaagaaatcgatgtgatttctgttccc
agcaagtgtctcctcctggtgcatgaacccaagttaaaagtggacttaacgaagtacctg
gagaaccaagctttctgctttgactttgcatttgatgagacagcttccaatgaagttgtc
tacaggttcacagcaaggccactggtacagacgatttttgaagggggaaaagcaacatgc
tttgcctatggacagacaggcagtgggaagacacatacaatgggtggagatctgtctggt
aaaagtcagaacgcatctaaagggatctacgccatggcttcccgggatgtcttccttctg
aagaaccagcctcggtaccggaacttaaacctggaagtttatgtgacattcttcgagatc
tacaatgggaaggtgtttgatctgctcaacaaaaaggccaagttacgtgtgctggaggac
agcaggcagcaggtgcaggttgtgggactgcaggagtacctggtcacctgtgctgatgat
gtcatcaagatgatcaacatgggcagtgcctgcaggacttctggacaaacatttgccaac
tccaattcctcccgctcccacgcctgcttccagattcttcttcgaactaaagggagatta
catggcaaattctctttggtggatctggcagggaatgaacgaggggccgacacatctagt
gctgaccggcagactcgcatggagggagcagaaattaacaagtctctcctggctctgaag
gagtgcatccgggcgctgggacagaacaaggctcacaccccgttccgtgagagcaagctg
acccaggtgctgagggactcgttcattggggagaactcgaggacctgcatgatcgccatg
atctcaccaggcataagctcctgtgaatacaccttaaacacgctgagatacgcagacaga
gtcaaggagctaagcccccacagcggacccagtggagagcagccggttcagatggaaaca
gaagtgatggaagccagctctaatgggacgtctctgactggcaatgaagaggaggagctg
tcttcccagatgtccagctttaatgaagccatgactcagatcagggagctggaagagagg
gccctggaagagctcagagagatcatacagcaaggaccaaactggcttgagctctccgag
atgacagatcagccagactatgacttggagacctttgtgaacaaagcagaatctgccctg
acacagcaggctaagcaggcgaagcacttctcagcccttcgagaagtcatcaaggccctg
cgcctagccatgcaactggaagaacaggctagcaaacaaataaacagcaagaaacggcac
caatga

DBGET integrated database retrieval system