KEGG   Mus musculus (mouse): 73827
Entry
73827             CDS       T01002                                 

Symbol
Tmem198b, 1110012D08Rik
Name
(RefSeq) transmembrane protein 198b
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4203
Other DBs
NCBI-GeneID: 73827
NCBI-ProteinID: NP_001345195
MGI: 1921077
Ensembl: ENSMUSG00000047090
Vega: OTTMUSG00000033535
Position
10; 10 D3
AA seq 350 aa
MEKASLPLTITSHPRPFNQQLPEPPAPRCVLEPQDSLDLAPALVCALCCCFGIIYCCFGY
RCFKAVMFLSGLLSGALVIFLLCHKERVLETQLSLEVSAGIALGIGLLCGLVTMLVRSVG
LFLTGLLLGLTLGVGTLLGTEPIYQPHSAWVPVGGLMGLALLGALLTLRWPRPFTVLGTA
LLGAAVLVACADYFLEGLALGTRLGERLQALPELLPLCWYSWVLLGTWPVLGALGTLAQW
KLMAEERGSRTNVILSHQQRHLQLLRIHQQQEAKRHRNSSGTGLCGGSYRNQLTPNIRSP
AHSPAPSYLQSLREYELVPGTQAPGTHTILDLDSDCSSTGLLTTPHSDQT
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggaaaaagcctcattgcctctgactataacatctcacccaaggccctttaaccaacaa
ctcccagagcccccagccccgagatgtgtcttggaaccccaggacagcctcgacttggcc
cctgcccttgtgtgtgccctttgctgctgcttcggaatcatctactgctgctttggctac
cgctgcttcaaggcagtgatgtttctctcgggtctgctgtcaggagccctggtgatcttc
ctcctgtgccataaagagcgggtgctagagacacagctgagcctggaggtgagcgcaggc
atagcactgggcatcggactcctctgcggcctggtcaccatgctggtccgcagtgtcggg
ctctttctgaccggtctcctgctaggtctgaccctgggtgttggaaccttattgggtact
gaacccatctaccagccgcattcagcctgggtgccggtcggcggactgatggggctggca
ctgctgggagccctgctcacacttcggtggccacgtccattcacagtcctgggcacagca
ctgctaggtgctgcggtgctggtggcctgtgctgactacttcctggaaggactggcactg
ggcactagactgggtgaacgcctgcaggcacttccagagttgcttcctctctgctggtat
agctgggtcttgctgggaacctggccagtcttgggggctcttgggacactggcccagtgg
aaactcatggctgaggaacgtgggagccgcaccaatgtgatcttgagccaccagcaaagg
catctccagctccttcggatccatcagcagcaagaggctaagaggcatcggaactcttct
gggacaggactgtgtggaggcagctatcggaaccagcttacccccaatatccggagccct
gctcacagtccagctccaagttatctccagagtcttcgagagtatgagctggtaccaggc
acccaggccccaggcacccacactatcctggacctggattctgattgcagctccactggc
ctgcttaccacacctcactctgaccagacctga

DBGET integrated database retrieval system