KEGG   Mus musculus (mouse): 73828
Entry
73828             CDS       T01002                                 

Symbol
Dcaf4, 1110018E21Rik, Wdr2, Wdr21
Name
(RefSeq) DDB1 and CUL4 associated factor 4
  KO
K11799  DDB1- and CUL4-associated factor 4
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    73828 (Dcaf4)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     73828 (Dcaf4)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40
Other DBs
NCBI-GeneID: 73828
NCBI-ProteinID: NP_001158728
MGI: 1921078
Ensembl: ENSMUSG00000021222
UniProt: A0A1Y7VNZ0
Position
12; 12 D1
AA seq 532 aa
MSGVLCSSLLGTDMDRNIWKSRRRRGRSRHQSPALGQCDSSERYATGASQSSQDSGHHDA
ESPSTSSSRTGESSVPELPGFYFDPEKNRYFRLLPGHNNCNPLTKEGIQQKEMESRRLQL
LQQEDMQKKKITRVGFNASSILRKNQLGFLNFSSYCRLSHELRVSCMERKKVEIQSSDPS
ALASDRFNFIMADTTSDRLFTVNDVKIGGSKYGIINLQGLKAPTFEVQMHENLYFTNRKV
NSVCWASLNHLDSHILLCLMGLAETPGCATLLPASLFVSNHQAGTDQPGMLCSFRIPGAW
SCAWSLNVQANNCFSTGLSRRVLLTNVVTGHRQSYRINSDVLAQQFAVKTPLLFNGCRSG
EIFAIDLRSPSQAKGWKATQIFHDSAVTSVQVFKEEQHLMASDMSGKIKLWDLRATKCVR
QYEGHVNEYAYLPLHMHEEEGILVAVGQDCYTRIWSLHDARLLRTIPSPCPTSKANIPSV
AFSPRLGGSRGAPGLLMAVQQDLYCFAYSSSCPDSQEEGRWELPSVSNEDIL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtctggcgttctgtgttcctctctcctaggaacggacatggataggaacatctggaag
agtaggagaagacgcgggcgaagccgacaccagagccctgccctggggcagtgtgattcc
agtgagaggtacgccacaggggcatctcagagctcacaagattctggccaccatgatgct
gagtccccgtcaacctcgtccagcagaactggagagtcttcagtgccagaacttccaggt
ttttactttgaccctgaaaagaaccgatacttccgtttgctcccgggtcacaacaactgc
aaccccctcacaaaggagggcatccagcaaaaggagatggagagcaggaggctgcagctg
ctgcagcaagaggacatgcagaaaaagaaaattaccagagtgggatttaatgcatcttcc
atcctacgaaaaaaccagctgggttttctcaacttctccagttattgccgtttatcccat
gagctgcgggtgagctgcatggagaggaaaaaggtagagattcagagctcagacccttct
gctctggcaagtgaccggtttaacttcatcatggcagacactaccagtgaccgcctcttc
acagtgaatgacgtcaaaatcggaggctccaagtacggcatcatcaacctgcagggtctc
aaggcccccacgttcgaggtgcagatgcatgaaaacctgtactttaccaacaggaaggtg
aactctgtgtgctgggcctcactcaatcacttggactcccacatactgctgtgcctcatg
ggccttgcagagacgccaggctgtgccaccttgctccccgcttcactgtttgtcagtaac
caccaagcaggtacagaccagcctggcatgctctgtagtttccggatccctggggcctgg
tcctgtgcctggtccttgaacgtccaggcaaataactgcttcagtacaggtttgtctcgg
agggtcctcttgaccaatgtggtgacaggacaccggcagtcatacaggatcaacagtgat
gtcttggcccagcagtttgcagtcaagactcctttgctgtttaatggctgtcgttctggg
gagatctttgccattgacctgcgttctccaagtcaagccaagggctggaaggctacccaa
attttccatgactcagccgtgacctctgtgcaggtcttcaaggaggagcaacacctgatg
gcgtcagacatgtctggaaagatcaagctgtgggacctgagggccactaaatgtgtgaga
cagtatgaaggtcatgtgaatgagtacgcctacctgccactgcatatgcacgaggaggaa
gggatcctggtggcagtgggccaagactgctacacacggatctggagcctccacgatgcc
cgcctgctcagaaccataccctccccatgcccaacctccaaggccaacattcccagtgtg
gccttctctcctcggcttgggggctcccggggcgccccagggctgctcatggccgtccag
caggacctgtactgtttcgcctacagctcgtcttgtccagacagtcaggaggagggcagg
tgggagctcccttctgtttccaatgaggacattttataa

DBGET integrated database retrieval system