KEGG   Mus musculus (house mouse): 73833
Entry
73833             CDS       T01002                                 
Symbol
Fam98c, 1110006G06Rik, B230110F21Rik
Name
(RefSeq) family with sequence similarity 98, member C
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF2465
Other DBs
NCBI-GeneID: 73833
NCBI-ProteinID: NP_001139495
MGI: 1921083
Ensembl: ENSMUSG00000030590
UniProt: E9PYD1
Position
7:complement(28851935..28855653)
AA seq 344 aa
MDGAMVAGDLLTLGYDALPEGASRGPACADFRALCARLAAELTALGALERREEGTAVLGA
GHGPDTEEEFLRQLAGWLRALHCPDRALCGGDCATVLREPGGGLRLLRFLCSELQAARLL
HLRLQRDSSPVPSFGEGTKKANGVVQELTLTLQALGLPRPLRGTLASQLLREFHDKISEL
LPSLPPESMKPLLNSQLDASRWEALESLSQSLTEQYCCRRCLLLKRLDLTTSAFHWGDRA
EAHGEVMKAVLSPIRGLLTPESDVSIAHVLAARADLSRLVPATSVAARRGTSCAINKVLM
GDVPDRGGRPSELEAPMPTWKSRREDGGRGKAGQQRWGRRKKKK
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggatggggccatggtagcgggtgaccttctgacactggggtacgatgccctcccggag
ggggcgtctcggggtcccgcgtgtgcagacttcagggcgctgtgcgcgcggctggcggcc
gagctgacggctctgggagctctggagcggcgagaggagggcaccgcagtgctgggcgcc
ggccacggcccggacacagaggaagagttcctgcggcagttggccggctggctgcgggcg
ttgcactgcccggatcgcgcgctctgcggcggagactgcgccaccgtgctgcgggagccc
ggcggcggcctgcgtctgctgcggtttctttgctctgagctccaggctgcccgcctcttg
catctaaggctccagcgggattctagccctgtgccatcctttggagaagggacaaagaag
gcgaatggcgttgttcaggaactgacgctaactcttcaagccctggggctccccagaccc
ctgcgtggaaccctggctagccagctacttcgggagtttcatgacaagatctctgagctg
ctgccgtccctgcccccggagtccatgaagcccctccttaactcgcagctggatgcatcc
cgatgggaagccctggagtctctgtcccaaagcctgacagagcagtactgctgccgccgc
tgcctcctcctgaagcgccttgacctcacaacatctgctttccactggggtgaccgggca
gaggcccacggagaggtcatgaaggcggtgctgtccccaatccgagggcttctgactcca
gaatctgatgtctctatcgcacatgttctggctgcccgagctgacctttcccgcctggtc
ccagctaccagtgtggctgcccgacgagggaccagttgtgcaatcaacaaggtgcttatg
ggtgatgtgccagaccgtggggggcgccccagtgagctggaagctcccatgcctacttgg
aagagccgacgagaagatggaggaagggggaaggctggccaacagcgctggggccgcaga
aagaagaagaagtga

DBGET integrated database retrieval system