KEGG   Mus musculus (mouse): 73834Help
Entry
73834             CDS       T01002                                 

Gene name
Atp6v1d, 1110004P10Rik, Atp6m, VATD, Vma8
Definition
(RefSeq) ATPase, H+ transporting, lysosomal V1 subunit D
  KO
K02149  V-type H+-transporting ATPase subunit D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00190  Oxidative phosphorylation
mmu01100  Metabolic pathways
mmu04145  Phagosome
mmu04150  mTOR signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04966  Collecting duct acid secretion
mmu05165  Human papillomavirus infection
mmu05323  Rheumatoid arthritis
Module
mmu_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    73834 (Atp6v1d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04150 mTOR signaling pathway
    73834 (Atp6v1d)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    73834 (Atp6v1d)
 09150 Organismal Systems
  09155 Excretory system
   04966 Collecting duct acid secretion
    73834 (Atp6v1d)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    73834 (Atp6v1d)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    73834 (Atp6v1d)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    73834 (Atp6v1d)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_D
Motif
Other DBs
NCBI-GeneID: 73834
NCBI-ProteinID: NP_076210
MGI: 1921084
Ensembl: ENSMUSG00000021114
UniProt: P57746 Q3U861
Position
12 C3; 12 35.51 cM
AA seq 247 aa AA seqDB search
MSGKDRIEIFPSRMAQTIMKARLKGAQTGRNLLKKKSDALTLRFRQILKKIIETKMLMGE
VMREAAFSLAEAKFTAGDFSTTVIQNVNKAQVKIRAKKDNVAGVTLPVFEHYHEGTDSYE
LTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRI
ERTLAYIITELDEREREEFYRLKKIQEKKKIIKEKFEKDLERRRAAGEVMEPANLLAEEK
DEDLLFE
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcaaagaccggattgaaatcttcccttcgcgaatggcacagaccatcatgaag
gctcgattaaaaggagcacagactggtcgaaaccttctgaagaaaaagtctgatgcctta
actcttcgatttcgacagatcctgaagaagataatagagactaaaatgctgatgggtgaa
gtgatgagagaagctgccttctcattggctgaggccaaattcacagcaggggacttcagc
accacagttatccaaaatgtaaataaagcccaagtgaagatcagagcaaagaaagacaat
gtagcaggtgttaccttgccagtgtttgaacattaccacgaaggaactgacagctatgaa
ctgaccggtttagccagaggtggggagcagctggctaaactaaagcggaattatgccaaa
gcagtggaactactggtggaactggcttccctgcagacttcctttgttaccctggatgaa
gccattaaaatcaccaacaggcgtgttaatgccattgagcatgtcattattccccggatt
gaacgcacccttgcctatatcatcacagaactggatgagagagagcgagaagaattctat
aggttaaagaaaatacaggagaagaaaaagattatcaaggaaaaatttgagaaggacttg
gagcggcggagagcagctggagaggtgatggagcctgccaacctgctggctgaagagaag
gatgaagacctgctgttcgaatag

DBGET integrated database retrieval system