KEGG   Mus musculus (mouse): 73873
Entry
73873             CDS       T01002                                 

Symbol
Fam161a, 4930430E16Rik
Name
(RefSeq) family with sequence similarity 161, member A
  KO
K16772  protein FAM161A
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    73873 (Fam161a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    73873 (Fam161a)
SSDB
Motif
Pfam: UPF0564
Other DBs
NCBI-GeneID: 73873
NCBI-ProteinID: NP_082948
MGI: 1921123
Ensembl: ENSMUSG00000049811
Vega: OTTMUSG00000005271
UniProt: Q8QZV6 B1AVK0
Position
11; 11 A3.2
AA seq 475 aa
MNFSDIYHSDEEYFRKLKDLKAVHEETMSKLEKMYQDKLNIKDIQAGFIRDGISDSSSSS
ASEKSCSHPALSVTSLSEPDLDGSSSLSTTTDEGLPDLEEKTPGESSAMVHAQELINNMW
NDFSVEDYIQYDSDSRTAKKKRKKAKSLTPKITVPVPFEMTVREQNRREKALSARSDLET
KLLKRDEDDAECKKKFRANPVPSCVLLPLYEDLVKQSEERRKKARERNRAALLASLKPFK
FIAREEQKQAVREKKLRDLFRAKRKTNQFKAKPVPRFIYRPAASDKPKEEELYGDSRMLP
KVRDLLQNSPWPSRSACRRFRDPRSPAKPRGKHRRRCLRRDGDLEKWKEPFSEYSFLKCP
MLCEECCLHESPCDSDKRQKLLADIRADEEILRETRRPGRSPRRKSPGRSSNPKPRPHEC
SPPMPTASSRGREQAIRRSEKARMREYWQELEEQEEKLQKRPMLFERVTQVVFIG
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgaacttctctgatatttaccactctgatgaagagtatttcaggaaactcaaagacctg
aaggctgtccatgaagaaaccatgtcaaaattagagaaaatgtaccaggacaagctaaat
ataaaagacatccaggcggggttcatcagggatgggatcagcgattcgtcttcgagttct
gcatcggaaaagagctgctcacatcctgccttgtcagtgacctcactttcagagcctgac
ctagacgggtcgtcctccttgtccacaactactgatgaggggttgcccgacctagaggaa
aagactcccggggaaagcagcgcaatggtccatgcccaggagctcataaacaacatgtgg
aacgacttttctgttgaagattatattcagtatgactcagactcccgaacagctaagaaa
aaaaggaagaaagctaaatccttgacacccaagattacagtgcctgtaccctttgaaatg
acggtaagagagcagaatcggagagagaaggccttgagtgctcggtcagatctggaaaca
aagctgctcaagagggacgaggacgatgcagagtgtaagaagaaattccgagccaatccc
gttccttcctgcgtgctccttcccctttatgaggatctagtcaagcagagtgaggagcgc
cggaagaaggcccgggagaggaacagagctgcgctcctggcctccctgaagccctttaag
ttcattgcgagggaggaacagaagcaagcagtccgcgagaagaagctgagagaccttttt
agggctaaaaggaaaacgaatcagtttaaagccaaacctgtgcctcgttttatttacagg
ccagctgcgagtgacaagccaaaggaagaagagctctatggggacagcaggatgctgcca
aaggtcagagatctgttacagaattcgccttggcccagtcggtcagcttgcagacgtttc
agggaccccagaagtcctgcaaagcccaggggtaaacacaggcgtaggtgcctgaggcgt
gatggagacttagaaaaatggaaggagcccttctctgaatacagctttctgaaatgccca
atgctttgtgaagagtgttgtcttcacgaatccccttgtgactctgataaaagacagaaa
ctcttggcagacatcagagcagatgaagaaattttgagagaaacacgcaggccgggtcgg
tctcctaggcgcaagtcaccgggaagaagctcgaacccaaagcccaggcctcatgaatgc
agcccaccgatgcccaccgcgtcttcccgagggcgggagcaagccatcagaaggagtgaa
aaggccaggatgagagaatattggcaagaactggaggaacaagaggaaaaactgcagaag
aggccgatgttgtttgaaagagtcacccaggttgtgtttattggttag

DBGET integrated database retrieval system