KEGG   Mus musculus (mouse): 73893Help
Entry
73893             CDS       T01002                                 

Gene name
Tmem202, 4930425N13Rik
Definition
(RefSeq) transmembrane protein 202
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin CD20
Motif
Other DBs
NCBI-GeneID: 73893
NCBI-ProteinID: NP_848475
MGI: 1921143
Ensembl: ENSMUSG00000049526
Vega: OTTMUSG00000063294
UniProt: Q80W35 B9EHM8
Position
9; 9 B
AA seq 275 aa AA seqDB search
MERKEQTMTFYSPEVIKIKGDLRYQRPTLPTNQQSVSTQKRQQYVNEACTYIRMFCGSLS
GFSVLLLACTSPLNLVQFLVNNNGLELKAGLWTLCYHELCWSHTPKPPYYLQYSRALFLI
SILFMLISLGLLLSSCRPAERMMSAELDLKVSMLSFCSAVSLLLCLNLFLAQVELYTKNA
MEYEFLWTYYLSWCSEVLYICVGIISFLNFITFQFHPPDEGVSADLWQKSRLGIGPVPKT
LSATAERSRSEMQFLSGRQEKLQNVRKGKLATTRL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggagagaaaggaacaaaccatgaccttttacagtcctgaggtcatcaaaataaagggg
gacctgagataccaacggcctacccttcctaccaaccaacaatccgtatcgacccagaag
cgacagcagtatgtgaatgaggcttgcacctacatccggatgttctgtggtagcctctct
ggctttagtgtcttgctactggcctgcacatccccactgaacttggtgcagttcctggtg
aacaacaatggccttgaactcaaagcaggactctggaccttatgctaccatgagctgtgc
tggagccacacacccaagccaccctattatctccagtactccagagccttgttcctcatc
tccatcctcttcatgcttatcagccttggcttgctcttgagctcttgccgccctgcagaa
agaatgatgtccgctgagttggatctgaaggtgtccatgctcagcttctgctcagctgtc
agcttgctcctctgcctcaacctgtttctggcgcaggttgaattatacacaaagaatgcc
atggagtatgagttcctgtggacctactatcttagttggtgcagtgaggtcttatatatc
tgtgttgggatcatctcttttctcaacttcataactttccaattccatcctcctgatgag
ggtgtcagcgcggatctatggcagaagtccaggctgggcattgggccagtgccaaaaaca
ctgtctgctacagctgaaaggtcacgttctgagatgcagtttctaagtgggagacaggaa
aaactacagaatgtgagaaagggaaaactggctaccacaagactgtga

DBGET integrated database retrieval system