KEGG   Mus musculus (mouse): 73914Help
Entry
73914             CDS       T01002                                 

Gene name
Irak3, 4833428C18Rik, AI563835, IRAK-M
Definition
(RefSeq) interleukin-1 receptor-associated kinase 3
  KO
K04732  interleukin-1 receptor-associated kinase 3 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04722  Neurotrophin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    73914 (Irak3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    73914 (Irak3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     73914 (Irak3)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: TKL group
  IRAK family
   73914 (Irak3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Death FTA2
Motif
Other DBs
NCBI-GeneID: 73914
NCBI-ProteinID: NP_082955
MGI: 1921164
Ensembl: ENSMUSG00000020227
Vega: OTTMUSG00000034096
UniProt: Q8K4B2 Q0VB14
Position
10; 10 D2
AA seq 609 aa AA seqDB search
MAGRCGARGALSPQLLLFDLPPALLGELCGILDSCDGPLGWRGLAERLSNSWLDVRHIEK
YVNQGKSGTRELLWSWAQKNKTIGDLLEVLQDMGHQRAIHLIINYGVSWTPSVQTHHELP
FPSFPPEVKHACRENDPGPLEPANVTVDNVLVPEHNEKGTLQKTPISFQSILEGTKHFHK
DFLIGEGEIFEVYRVDIRNQAYAVKLFKQEKKMQLKKHWKRFLSELEVLLLFRHPHILEL
AAYFTETEKLCLVYPYMSNGTLFDRLQCTNGTTPLSWHVRISVLIGIAKAIQYLHNTQPC
AVICGNVSSANILLDDQLQPKLTDFAAAHFRPNLEQQSSTINMTGGGRKHLWYMPEEYIR
QGRLSVKTDVYSFGIVIMEVLTGCKVVLDDPKHVQLRDLLMELMEKRGLDSCLSFLDRKI
PPCPRNFSAKLFSLAGRCVATKAKLRPTMDEVLSSLESTQPSLYFAEDPPTSLKSFRCPS
PLFLDNVPSIPVEDDENQNNHSVPPKEVLGTDRVTQKTPFECSQSEVTFLGLDRNRGNRG
SEADCNVPSSSHEECWSPELVAPSQDLSPTVISLGSSWEVPGHSYGSKPMEKRCSSGLFC
SEHEQSKKQ
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggccggccggtgcggggcccgtggcgcgctgtcgccacagttgctgctcttcgacctg
ccgcccgcactgctgggagagctttgcgggatcctggacagctgcgatggcccgctcggc
tggcggggcctggcggagcgactttcaaacagctggctggatgttcgtcatattgaaaag
tacgtaaaccaaggtaaaagtggaacaagagaattgctctggtcctgggcacagaaaaac
aagacgatcggcgaccttttagaggttctccaggacatggggcatcaacgagctatccac
ttaatcatcaactatggagtaagctggactccttcagtgcagacgcatcacgagcttcca
ttccccagcttcccacctgaggtgaagcatgcgtgcagagaaaacgaccctggacctctg
gaaccagccaatgtcacagtggataatgttcttgttcctgaacataatgaaaaaggaaca
ctgcagaaaacccctatcagcttccagagtatcctagaaggaaccaaacatttccacaaa
gacttcctgattggagaaggggagatattcgaagtatacagagtggacattcgaaaccaa
gcatatgctgttaaattgtttaaacaggagaaaaaaatgcaactaaagaagcactggaag
agatttttatcagaactggaagttctactcctgttccgtcacccccacatactagagctg
gctgcatatttcacggagactgagaaactttgtctggtttatccctatatgagcaacggg
acgcttttcgacagattacagtgcacaaatggcacaaccccgctttcctggcacgttcga
atcagcgtattgataggaatagccaaagccatccaatacttgcacaacactcagccgtgc
gccgtcatctgtggcaacgtttccagtgcaaacatactcttggatgaccagctccaaccc
aaactaacggattttgctgcagcgcacttccgacccaatctagagcagcagagttctacc
ataaatatgaccggcggtggcaggaaacatctgtggtacatgccagaagaatacatcaga
cagggaagactttccgttaaaactgatgtctacagcttcggaatcgtgatcatggaggtt
ctaacgggctgcaaagtggtgctggatgacccgaaacacgttcagctgcgggacctcctc
atggaactgatggagaaaagaggcctagactcctgcctgtccttcttagacaggaagata
ccaccctgtcctcggaacttctctgcaaagctcttctctctggcgggccggtgtgtggca
acgaaggccaagttaagacccacgatggacgaagtcctgtcctctctggagagcacccag
cctagcttgtattttgcagaagaccctcccacgtccttgaagtccttcaggtgtccttct
ccactgttcttggataatgtcccaagtattccagtagaagatgatgaaaaccagaataac
cattcagtacctcccaaggaagttttggggacagatagagtgactcagaaaacccccttt
gaatgcagccagtctgaggtcacctttctaggcttggaccgaaacagagggaacagggga
agtgaagcggattgcaacgtgcccagttcttctcatgaggaatgctggtccccagagctt
gtggcgccatcccaggacttaagtcctactgtgatcagtttgggctcgtcttgggaagta
ccaggccattcttatgggagcaagccaatggagaagaggtgttcctctgggctcttttgc
agtgagcatgaacagtccaaaaagcagtga

DBGET integrated database retrieval system