KEGG   Mus musculus (mouse): 74013
Entry
74013             CDS       T01002                                 

Gene name
Rftn2, 2700010E02Rik, 3222401M22Rik
Definition
(RefSeq) raftlin family member 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: Raftlin DUF5859
Other DBs
NCBI-GeneID: 74013
NCBI-ProteinID: NP_082989
MGI: 1921263
Ensembl: ENSMUSG00000025978
Vega: OTTMUSG00000021806
UniProt: Q8CHX7
Position
1; 1 C1.2
AA seq 500 aa
MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTLQASTNPDVIKINSVL
DIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSRLKLSPKHSAAGGQRRA
RLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQCYLPSMHCNGASHDGVAE
SGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQTERNSSPSYANPKRGEAP
DGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDANWLELTTFYYKQGFSLIDS
FVCWETPKGDQLPKSLEGFFIYEEEGSGVPGSNRRGNDAIVVEQWTVIEGCEIKTDYGPL
LHTLAEFGWLLTSVLPTPILRHDSEGNLATKQVVFLQRPVTWNSAAQTPERKGSRLLKGE
DRNKVSSRSLGLDTNASQAAGGRAPLEEGSLSPSRECWTKEERPAQSDSFSGFSSSDSVL
RELDDGQFDQEEGVTQVTCM
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggggtgcggacttaggaagctggaagaccctgatgaaagcagccctggaaaaatattt
tctaccctgaagagaccgcaagtggaaacaaagacagaatttgcttatgaatacgccctg
ctggactttactttacaagcttcaacaaatccagacgtcatcaagataaattcagtcctg
gatatagttgccaaagtggaagactattatcttaagggctatgttgttggggccattcac
ccagttatacaacctgtggggcagcggaagcaccttccagcaagtcacctgtacagggcg
gtgctgtcccggctgaagctaagccccaagcattctgcagcaggcggacaaaggcgcgca
aggcttgtgatggaggagtgtccactaacttgtgaggcacaagcaaacgacgctgcaaag
gaactcatggacaagattaatgccgctgctaaaagagggatgaagtttgttgggctggtc
tcccagtgctacttgccatctatgcactgtaatggagccagccacgatggagttgcagag
tcggggctacacgtgagacaagattcacaagacaactgcaaaggctggaatgaaggagcc
cttggtggacacttgtctgaaagtggagtggaggaggaacctcagcatgaaagtggacag
catcagacagagaggaacagcagccccagctacgctaacccaaagcggggagaagcccca
gatggtaagctgtacatggtcttcaatgcttttgaggaagatgcggccagctgggcctat
caggaaggtgtcctgtccatgaaagtgacgcggaagggagctgtcatcagcgctctggac
gccaactggctagaactaacgacattttactataagcaaggcttctctttaattgactct
tttgtgtgctgggagacacctaaaggggaccagttacctaaatctttggaaggctttttt
atctacgaagaagaaggatctggagtcccaggttctaacaggagaggaaacgacgccatt
gtggtggagcagtggacagtcattgagggctgtgaaattaaaacagattacggccccctg
ctgcacaccctggctgagtttggatggcttctgacaagcgtgttgcctaccccgatattg
agacatgacagtgaagggaatttggctaccaagcaagtcgtatttctccaaaggccggtt
acgtggaactcagctgctcaaaccccagaaaggaaaggcagccggctgctgaagggtgaa
gacagaaacaaggtcagcagcaggagcctaggcctggacacaaatgcatcccaagccgca
ggaggccgagcccctcttgaggagggctccctctctccgtccagggagtgctggaccaag
gaagagcggcccgcacagagcgacagcttctctgggttcagtagcagtgacagtgtcctc
cgggaactcgatgacggacagtttgaccaggaagagggcgtgacacaggtcacttgcatg
tga

DBGET integrated database retrieval system