KEGG   Mus musculus (mouse): 74018Help
Entry
74018             CDS       T01002                                 

Gene name
Als2, 3222402C23Rik, 9430073A21Rik, Als2cr6, Alsin, mKIAA1563
Definition
(RefSeq) alsin Rho guanine nucleotide exchange factor
  KO
K04575  amyotrophic lateral sclerosis 2 protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05014  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    74018 (Als2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    74018 (Als2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    74018 (Als2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RCC1 RCC1_2 MORN VPS9 RhoGEF DUF2973 PH
Motif
Other DBs
NCBI-GeneID: 74018
NCBI-ProteinID: NP_001153420
MGI: 1921268
Ensembl: ENSMUSG00000026024
Vega: OTTMUSG00000021752
UniProt: Q920R0
Position
1; 1 C1.3
AA seq 1651 aa AA seqDB search
MDSKKKSSTEAEGSKERGLVHVWQAGSFSLTPERLPGWGGKTVLQAALGVRHGVLLTEDG
EVYSFGTLPWKSESAEICPSSPLLESALVGHHVITVATGSFHSGAVTESGVVYMWGENAA
GQCAVANQQYVPEPSPVSISDSETSPSLAVRILQLACGEEHTLALSLSREIWAWGTGCQL
GLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPPQDLKPVPERCNQCSQLLI
TMTDKEDHVIISDSHCCPLGVTLSESQAEKHASPAPSPHPEALDEQGEVFENTVVEAELN
MGSSQTTSGSAISTQQNVVGTAEVSSARTAPSYPDTHAVTAYLQKLSEHSMRENHEPGEK
PPQVQPLVEEAVPDLHSPPTTSTSALNSLVVSCASAVGVRVAATYEAGALSLKKVMNFYS
TAPCETAAQSGSASTGPESLKDLREEQVKQESLQGKKSSSLMDIREEELEGGSRRLSLPG
LLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPSLRTEVWTWGKGKEGQLGHGDVLP
RLQPLCVKCLDGKEVIHLEAGGSHSLALTAKSQVYSWGSNTFGQLGHSEFPTTVPRLSKV
SSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQDRAEGDTLPENPSGTKTPVLLSCSK
LGYISRVTAGKDSYLALVDKNIMGYIASLHELASTERRFYSKLSEIKSQILRPLLSLENL
GTVTTVQLLQEVASRFSKLCYLIGQHGASLSSYLQGMKEASSLVIMKHSSLFLDSYTEYC
TSVSNFLVMGGFQLLAKPAIDFLNKNQELLQDLSEVNDENTQLMEILNMLFFLPIRRLHN
YAKVLLKLATCFEVTSPEYQKLQDSSSCYESLALHLGKKRKEAEYTLSFWKTFPGKMTDS
LRKPERRLLCESSNRALSLQHAGRFSVNWFILFNDALVHAQFSTHHVFPLATLWAEPLSE
EAGSVNGLKITTPEEQFTLISSTPQEKTKWLRAISQAVDQALRGTSDFPLYGGGSSVQRQ
EPPISRSAKYTFYKDTRLKDATYDGRWLSGKPHGRGVLKWPDGKMYSGMFRNGLEDGYGE
YRIPNKALNKEDHYVGHWKEGKMCGQGVYSYASGEVFEGCFQDNMRHGHGLLRSGKLTSS
SPSMFIGQWVMDKKAGYGVFDDITRGEKYMGMWQDDVCQGNGVVVTQFGLYYEGNFHLNK
MMGNGVLLSEDDTIYEGEFSDDWTLSGKGTLTMPHGDYIEGYFSGEWGSGIKITGTYFKP
SLYESDKDKPKAFRKLGNLAVAADEKWRAVFEECWRQLGCESPGQGEVWKAWDNIAVALT
TNRRQHKDSPEILSRSQTQTLESLEYIPQHIGAFSVEKYDDIKKYLIKACDTPLHPLGRL
VETLVAVYRMTYVGVGANRRLLQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTIPLSAPL
PTGRRSFCTGKSDSRSESPEPGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDREEDIYWE
CVLRLNKQPDIALLGFLGVQKKFWPATLSILGESKKVLSTTKDACFASAVECLQQISTTF
TPSDKLKVIQQTFEEISQSVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIED
LMDPFLQHGEQGIMFTTLKACYFQIQREKLN
NT seq 4956 nt NT seq  +upstreamnt  +downstreamnt
atggactcaaagaagaaaagctcaacagaggcagaaggatccaaagaaagaggcctagtc
catgtctggcaggcaggatccttttctctaacaccagagaggttgccaggctggggtgga
aagacagttcttcaggcagcccttggtgtgaggcatggagttcttctgactgaagatggt
gaggtctacagctttgggactcttccctggaaaagtgaatcagcagaaatttgtccaagc
agcccccttctagaaagtgccctggttgggcatcatgttattactgtggcaacagggagc
ttccacagtggagcagtgacagagagcggggtggtgtacatgtggggagagaatgctgcc
gggcagtgtgcggtagctaaccagcagtatgtgccggagccgagtcctgtcagcatttct
gactcggagaccagcccgtcattagcagttaggattctgcaattggcatgtggcgaggaa
cacacactggcattgtcactcagcagagagatctgggcatggggcaccggctgtcagctg
ggcctcatcaccaccactttcccagtgacaaagccacagaaggtggaacaccttgctgga
cgcgtggtgctccaggtggcctgcggtgcattccacagccttgcacttgtgcagtgcctc
cctcctcaggatctgaagccagtcccagagagatgcaatcagtgcagccagctgctcatc
accatgacagacaaagaggaccatgtgataatatcggacagccattgctgccctttaggt
gtgacattgtccgagtctcaagcagaaaagcatgccagccctgctcccagccctcaccca
gaggcactggatgagcagggagaggtgtttgagaacacggtggtagaagctgaactgaac
atgggaagcagtcagaccacaagtggcagtgccatttccacccagcagaacgtcgtggga
acagctgaagtgtcttctgccagaacagctccgtcatacccagacacccatgcggtaact
gcatacctgcagaagctgtcagagcattcgatgagggagaaccatgagcctggagaaaag
ccaccccaggtccagcctcttgtagaagaagcagttcctgatcttcacagtccaccaacc
acaagcacctcagccctcaacagcttggtggtctcctgtgcatctgctgttggtgtcaga
gtggctgccacctatgaagctggggccttgtctctcaagaaagttatgaacttttacagc
actgccccctgcgagacggcagctcagtcgggcagtgcctccacaggcccagaaagtctg
aaagatctccgagaagagcaggtgaaacaggagtcactgcaagggaagaaaagctcaagt
ctcatggacatcagagaggaggagttggagggagggagtcgaagactctccctcccaggg
ttgttgtcgcaagtttcccccaggctcttaaggaaggctgcgagggtgaaaactcggaca
gtggttctgactcccacatacagtggagaagcagatgcccttctgccttccctgaggaca
gaggtgtggacctgggggaaaggcaaggaagggcagctagggcacggcgacgtcctgccc
aggcttcagccgttgtgtgtcaagtgtctggatggtaaagaggtaatccacctggaggcg
ggcggctcccactccctcgcactcactgcgaaatctcaggtttactcatggggcagtaat
acctttggtcagcttgggcattctgagtttccaacaacggttcctcgactctcaaaggtt
agcagtgaaaatggagtctggagtgtagctgcaggccaagattattccttgtttttagtg
gacacggaagacttccagcctgggttgtattacagtggccgacaggaccgtgcagaaggt
gataccctgccagagaatcccagtggtacaaagactccagtacttctctcctgtagtaag
cttggatacataagcagagtaacagcaggaaaagatagctatctagccttggtggataag
aacatcatgggatacatcgccagtctccatgagttggcttctacagaaagacggttttac
tcaaaactgagcgaaatcaaatcacagatacttaggcctcttctcagtttagaaaatttg
ggcacagtgaccactgtccagctgttgcaggaagttgccagccggttcagcaagttgtgt
tacctcattgggcagcatggagcctcactaagcagctacctacagggcatgaaggaagcc
agcagcctggtcatcatgaagcactcaagtcttttcctggacagctacacagagtactgc
acatcagtttcaaatttcctggttatgggaggattccagcttcttgctaagcctgccatt
gatttcctaaataaaaaccaagaactcttgcaagatttgtcagaagtgaatgatgagaac
actcagttgatggaaatcctgaacatgctgtttttcttgccaatcagacgacttcataat
tatgcaaaagttttgctaaagcttgccacttgctttgaagtgacatctccagagtatcaa
aagctgcaggattccagttcttgctatgagtctcttgctctccatcttggcaagaagagg
aaggaagcagagtacacactgagcttctggaagacctttcctgggaaaatgacggattcc
ttgaggaagccagagcgccggctgctgtgtgagagcagtaaccgagccctctccctgcag
catgccggcaggttttctgtgaattggttcattctcttcaatgatgccctggtccatgct
cagttctctacacaccacgtgttccctttggccacactctgggcagagccactttctgaa
gaagctggtagcgtgaatggcttaaagataactacacctgaagaacaattcacactcatt
tcttcaacaccccaggaaaagaccaagtggcttcgggctatcagccaagctgtggatcag
gctttgagggggacgtccgatttcccactttacggaggcggcagcagtgttcagagacag
gaaccacccatctcaagaagtgccaaatacactttctacaaggatactcgcctaaaggat
gccacttacgatgggcgctggctttcagggaagcctcatggcaggggtgttctgaagtgg
cctgatggaaagatgtactctggcatgttcaggaatggcttggaagatggatatggtgaa
tacagaatccctaacaaggccctgaacaaagaagaccattatgtaggccattggaaagag
gggaaaatgtgtgggcaaggagtctacagctatgcctctggtgaagtgtttgaaggctgc
tttcaagataacatgcgccatgggcatggtctgctccggagtggaaaactgacttcttct
tctcctagcatgttcattggccagtgggtaatggataagaaagcaggatatggcgtcttt
gatgatatcaccaggggagaaaagtacatgggaatgtggcaggatgatgtgtgccaaggg
aatggggtagtagtcacccagtttgggttatactacgaaggcaacttccacctgaataag
atgatgggaaatggggttttgctttctgaagatgataccatctatgaaggagaattttcc
gatgactggacacttagtggaaagggaacgctgactatgccacatggagattatattgaa
ggttattttagtggagaatggggatctgggataaaaatcactgggacctacttcaaacct
agcctgtatgagagcgataaggacaagcccaaagccttcaggaagctggggaacctggcc
gtggcagcagacgagaaatggagagcagtgtttgaagaatgctggcgccagctgggctgt
gagagcccaggccaaggggaggtttggaaagcatgggataatattgctgtggccttgacc
acgaaccgtcgccagcataaagacagtccagaaatactaagccgctctcagactcagacc
ctggagagtttggagtacattccccagcacattggcgccttctctgtggagaaatatgat
gacatcaagaagtatttaataaaggcctgtgatactcctctgcacccactgggcaggctt
gtggagaccctggttgcggtgtatagaatgacatatgtgggtgtaggggccaaccgccgg
ttactgcaggaagctgtgaaggagattaaatcttatctcaagaggattttccagcttgtg
aggttcttgtttcctgagcttcctgaggagggcagcacaattcctctttctgctcctctg
cccactggaaggagatccttctgtactggaaaatcggattccagatccgagtcaccagaa
ccaggttatgtagtaacaagttctggcttactgcttccggtgctgctgccacggctctac
ccacctctcttcatgctctatgccctggataatgaccgagaggaagacatttactgggaa
tgtgtgcttcgactaaacaagcagccagatattgctctcttgggcttccttggagtacag
aaaaaattctggccagccaccttgtcaatccttggagagagtaaaaaggtgttgtcaacc
acaaaggatgcttgctttgcatctgcagtagaatgcctgcagcagatcagcacaacattt
actccatcagacaagcttaaagtgatccagcagacctttgaagagatctcccagagtgtc
cttgcatcgctgcaggaggacttcctctggtccatggatgacttgttccccgtcttctta
tacgtggtgctgcgggccaggattcggaacttgggctctgaagttcacctcattgaggat
ctgatggacccctttctccagcatggggaacaaggcatcatgttcaccaccttgaaggcc
tgttacttccagattcagcgggagaagcttaactag

DBGET integrated database retrieval system