KEGG   Mus musculus (house mouse): 74022
Entry
74022             CDS       T01002                                 
Symbol
Glyr1, 2810419J22Rik, 3930401K13Rik, AW545332, NDF, Npac
Name
(RefSeq) glyoxylate reductase 1 homolog (Arabidopsis)
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 PWWP F420_oxidored 2-Hacid_dh_C Shikimate_DH 3HCDH_N ApbA
Other DBs
NCBI-GeneID: 74022
NCBI-ProteinID: NP_082996
MGI: 1921272
Ensembl: ENSMUSG00000022536
UniProt: Q922P9
Position
16:complement(4831766..4867780)
AA seq 546 aa
MAAVSLRLGDLVWGKLGRYPPWPGKIVNPPKDLKKPRGKKCFFVKFFGTEDHAWIKVEQL
KPYHAHKEEMIKINKGKRFQQAVDAVEEFLRRAKGKDQTSSHTSADDKNRRNSSEERSRP
NSGDEKRKLSLSEGKVKKNMGEGKKRVTSGSADRGSKCLKRAQEQSPRKRGRPPKDEKDL
TIPESSTVKGMMAGPMAAFKWQPTATEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKI
CEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAE
KEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADT
VTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFL
GEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQ
NILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAV
YRAYIH
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggcggctgtgagtctgcggctcggcgacttggtgtgggggaaactgggccggtatcct
ccctggccaggaaagattgttaatccacccaaggacttaaagaaaccacgtggaaagaaa
tgcttctttgtgaagttttttggaacagaagatcatgcctggatcaaagtggaacagcta
aagccttaccatgctcacaaggaggagatgataaagattaacaagggtaaacggttccag
caagctgtggatgctgttgaagagttcctcaggagagccaaagggaaagaccagacatca
tcccacacttctgctgatgacaagaatcggcgtaattccagtgaggagagaagtaggcca
aactcaggtgatgagaaacgcaagcttagcctgtctgaagggaaggtgaagaagaacatg
ggagaaggaaagaagagggtgacttcaggctctgcagacagaggctccaaatgccttaaa
agagcccaagagcaaagtccccggaagcggggtcggcccccaaaggatgagaaggacctc
accatccctgagtctagcactgtaaaggggatgatggctggaccgatggctgcatttaaa
tggcagccaacagcgaccgagccagtcaaagatgcagatcctcattttcatcattttctg
ttgagccaaacagagaagccagctgtctgttaccaggcaatcacaaagaagttgaaaata
tgtgaagaggaaactggttccacctccatccaggcagcagacagcacagctgtgaatggc
agcattacacccacagacaaaaagataggatttttgggccttggcttaatgggaagtggc
atcgtctccaacttgctaaaaatgggtcacacagtgactgtctggaaccggactgcagag
aaagagggggcccgcctaggaagaacccccgctgaagtcgtttcaacttgtgacatcact
tttgcctgtgtgtcggatccaaaggcagccaaggacctggtgctgggccccagcggtgtg
ctgcaaggaatccgccccgggaagtgctatgtggacatgtcaacggtggatgcggataca
gtcaccgagctggcccaggtgattgtatccagagggggacgctttctggaagcaccagtc
tcagggaatcagcaactgtccaatgatgggatgttggtgatcttagcagccggagacagg
ggcttgtatgaggactgcagcagctgcttccaggcaatgggaaagacctccttcttttta
ggtgaagttggcaatgcagccaagatgatgctgattgtgaacatggtccaagggagcttc
atggccaccattgctgaggggctcacgctggcccaagtgacaggccaatcacagcagaca
ctcttggacatccttaatcagggacaattggccagcatctttctggaccagaagtgccaa
aatatcctacaaggaaactttaaacctgacttctacctgaaatacattcagaaggatctc
cgcctggccattgcattgggtgatgcagtcaaccaccccactcccatggcagctgcagcc
aatgaggtatacaaaagagccaaggcactggaccagtctgacaatgatatgtctgccgtg
taccgagcctacatacactaa

DBGET integrated database retrieval system