KEGG   Mus musculus (mouse): 74026
Entry
74026             CDS       T01002                                 

Gene name
Msl1, 2810017F12Rik, 4121402D02Rik, 4930463F05Rik, AA682082, Msl-1
Definition
(RefSeq) male specific lethal 1
  KO
K13163  male-specific lethal 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    74026 (Msl1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    74026 (Msl1)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   hnRNP proteins
    74026 (Msl1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    MSL complex
     74026 (Msl1)
Motif
Pfam: PEHE MSL1_dimer Herpes_UL6
Other DBs
NCBI-GeneID: 74026
NCBI-ProteinID: NP_082998
MGI: 1921276
Ensembl: ENSMUSG00000052915
Vega: OTTMUSG00000006405
UniProt: Q6PDM1
Structure
PDB: 
2Y0M 2Y0N

Position
11; 11 D
AA seq 616 aa
MTMRSAVFKAAAAPAGGNPEQRLDYERAAALGGPEDESGAAEAHFLPRHRKLKEPGPPLA
SSQGGSPSPSPAGCGGGKGRGLLLPAGAAPGQQEESWGGSVPLPCPPPATKQAGIGGEPV
AAGAGCSPRPKYQAVLPIQTGSIVVAAAKEPTPWAGDKGGAAPPAATASDPAGPPPLPLP
GPPPLAPTATAGTLAASEGRWKSIRKSPLGGGGGSGASSQAACLKQILLLQLDLIEQQQQ
QLQAKEKEIEELKSERDTLLARIERMERRMQLVKRDNEKERHKLLQGYEPEEREEAELSE
KIKLERQPELCETSQALPSKPFSCGRSGKGHKRKTPFGNTERKTPVKKLAPEFSKVKTKT
PKHSPIKEEPCGSISETVCKRELRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSS
EMEDLPYLSTTEMYLCRWHQPPPSPLPLRESSPKKEETVARCLMPSSVAGETSVLAVPSW
RDHSVEPLRDPNPSDILENLDDSVFSKRHAKLELDEKRRKRWDIQRIREQRILQRLQLRM
YKKKGIQESEPEVTSFFPEPDDVESLLITPFLPVVAFGRPLPKLAPQNFELPWLDERSRC
RLEIQKKHTPHRTCRK
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgaccatgagatccgcagtgttcaaggcggccgcggcccctgccggcggcaaccccgag
cagcgactggactacgagcgggctgcggcgctgggcgggcccgaggacgagtccggggcg
gccgaagcccatttcctcccccggcatcgtaagctcaaggagccggggcccccgctggcc
tcttcccagggcgggagcccctcgccctctccagccggctgcggcggcggcaagggccgg
ggcttgttactcccagccggggcggcccccgggcagcaggaagagagctggggcggttcg
gtgcccttgccctgtccgcccccagctactaaacaagccggcatcggcggggagccagtc
gcagccggcgctggctgcagcccccggcccaagtatcaggcggtgctgcccattcagacg
ggctctatcgtggtggcggcggccaaagagcctacgccctgggctggggacaagggtggg
gcggctcccccagctgccaccgcctcggacccggcgggacccccaccactacctctgccc
gggccaccacccctcgcgcccaccgccactgctgggaccctggcggccagtgagggcaga
tggaagagtataaggaagagccctctcgggggtggcggcggctcgggagcctccagtcag
gccgcctgcctcaaacagatccttctgctgcaattggacctcatcgaacagcagcagcag
cagttgcaggccaaggagaaggagatagaggagctgaagtccgagagagatacgctcctt
gctcggattgaacgtatggaaaggcggatgcagctggtgaagagggataacgagaaggaa
aggcacaagctgctccagggctatgaacctgaagagagagaggaagcagagttgtctgag
aaaattaaattggagcgccagccggagctttgcgagacctcccaggctctgccttccaag
cctttctcatgtggccggagtggaaagggacacaaaaggaaaaccccatttggaaataca
gaaagaaagactcctgttaaaaagctggctcctgaattttcaaaagtcaaaacaaaaact
cctaagcactctcccattaaagaggaaccctgtggttccatatcagaaactgtttgtaaa
cgtgaattgaggagccaagaaaccccagaaaagccccggtcttcagtggataccccacca
agactctcgactccccaaaagggacccagcacccaccccaaggagaaagccttctcaagt
gagatggaagatttgccgtacctttccaccacagaaatgtatttgtgtcgttggcaccag
cctcccccatcaccgttaccattacgggaatcctctccaaagaaggaggagactgtagca
aggtgtctgatgccatcaagtgttgcaggagaaacttcagtcttggctgttccttcttgg
agggaccactcagtagagcctctaagggacccaaatccttcagacattttggagaacctg
gatgacagtgtattttcaaagaggcatgcaaaactggagctagacgagaagaggagaaaa
cgatgggatattcagaggatcagggaacaaagaattttacagcgactgcagctcagaatg
tataaaaagaaaggaattcaggaatctgagcctgaggttacctcatttttccctgagcca
gatgatgttgaaagtttgctgattacccccttcttgcctgttgtagcatttggacggcca
ttgccaaaattagctccacagaactttgaactaccctggttggatgagcgaagccgttgc
aggttggagatccagaagaagcacacacctcaccggacctgtaggaagtag

DBGET integrated database retrieval system