KEGG   Mus musculus (mouse): 74043
Entry
74043             CDS       T01002                                 

Gene name
Pex26, 4632428M11Rik
Definition
(RefSeq) peroxisomal biogenesis factor 26
  KO
K13340  peroxin-26
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    74043 (Pex26)
SSDB
Motif
Pfam: Pex26 TEDC1
Other DBs
NCBI-GeneID: 74043
NCBI-ProteinID: NP_083006
MGI: 1921293
Ensembl: ENSMUSG00000067825
Vega: OTTMUSG00000026945
UniProt: Q8BGI5
Position
6; 6 F1
AA seq 305 aa
MKSDASTSAAPLKGLVGPLRSSEPALALPAVSPAVHLLEEASDLLVVHLDFHAALETCER
AWQSLAEEPVSGTIVEVKCSLCVVGIQALAEMDRWREALSWVLRYYQVPEKLPPKVLELC
ILLYSKMKEPGAVLDVASAWLQDPDNQGLPDYGSLARLHVFRLLLPSGRLSEAEELAVRS
AAFSEEQRVEALQAIHLARQQHTQEHTQEHSDSQEPQKLRQEGSFSQKLLSLLMLLRRLW
GSVVSHLLSQPFRKGLLAALILCLLILRFDPAAPSSLPFLYQLTQLFRRIQKATLSRLYP
LALRD
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaagagcgacgcctcgacgtctgcagcccctttgaaagggctcgtgggccctctgcgg
agcagcgagcccgcgctcgccctccccgctgtgtcccccgcggtgcacctgctggaagag
gcgtccgacctgttggtggtgcacctggacttccatgccgcactagagacttgcgaacga
gcctggcagagcctggcggaggagcccgtgagtggcaccattgtggaggtgaaatgctcc
ctgtgtgtggtggggatccaggctctggcagaaatggatcgatggagagaagccctgtcc
tgggtcctccggtactaccaggttcctgaaaagctgcctcccaaagtcctggagctgtgc
atccttttatacagcaaaatgaaagagcccggagctgtgctggatgtggccagtgcctgg
ctccaagatccagataaccagggccttcctgattatggatcgctggccagactccacgtg
ttccggctgctgctaccctcgggtcgcttgtcagaggccgaggaactggcagtgcgctct
gcggccttcagcgaggagcagcgggtagaagcgctccaggccatccacttagcacggcag
cagcacacgcaagagcacacgcaggagcactcggactcccaggagccccagaagctgagg
caggaaggttcgttctcccagaagttgctgtcgctgctgatgctgcttcgccggctctgg
ggctccgtggtgagccacctcctctcgcagcccttcagaaagggcctcctggctgccttg
atcctctgcctcttgattctacggtttgacccagcagctccttcttcgctgcccttcctc
taccagctgacccagctcttccgccggatccagaaggccacactttctcggctctacccc
ctcgccctccgggactga

DBGET integrated database retrieval system